BLASTX nr result
ID: Rehmannia25_contig00029292
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00029292 (409 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61331.1| hypothetical protein M569_13466 [Genlisea aurea] 61 1e-07 >gb|EPS61331.1| hypothetical protein M569_13466 [Genlisea aurea] Length = 285 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = -3 Query: 407 ESSGLIDDDQKAKIDNNNPPLSFLEKWLLDESAGQVEGAMELPPIF 270 E SGL+D K + D++ PPLSFLEKWLLDESAG EGAMELP +F Sbjct: 241 EGSGLVDSRGKIEGDDH-PPLSFLEKWLLDESAGHGEGAMELPSLF 285