BLASTX nr result
ID: Rehmannia25_contig00029000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00029000 (571 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004244266.1| PREDICTED: TPR repeat-containing thioredoxin... 78 1e-12 ref|XP_006348295.1| PREDICTED: TPR repeat-containing thioredoxin... 77 2e-12 gb|EPS72637.1| hypothetical protein M569_02119, partial [Genlise... 68 2e-09 gb|EMJ12561.1| hypothetical protein PRUPE_ppa002367mg [Prunus pe... 67 3e-09 gb|EXC18487.1| TPR repeat-containing thioredoxin TTL1 [Morus not... 63 5e-08 ref|XP_006592931.1| PREDICTED: TPR repeat-containing thioredoxin... 62 8e-08 emb|CAN62839.1| hypothetical protein VITISV_003392 [Vitis vinifera] 62 1e-07 gb|EOY13241.1| Tetratricopetide-repeat thioredoxin-like 1 isofor... 62 1e-07 gb|EOY13240.1| Tetratricopetide-repeat thioredoxin-like 1 isofor... 62 1e-07 gb|EOY13239.1| Tetratricopetide-repeat thioredoxin-like 1 isofor... 62 1e-07 gb|EOY13238.1| Tetratricopetide-repeat thioredoxin-like 1 isofor... 62 1e-07 ref|XP_003541820.1| PREDICTED: TPR repeat-containing thioredoxin... 62 1e-07 ref|XP_004294076.1| PREDICTED: TPR repeat-containing thioredoxin... 61 2e-07 ref|XP_002283097.2| PREDICTED: TPR repeat-containing thioredoxin... 60 3e-07 emb|CBI20201.3| unnamed protein product [Vitis vinifera] 60 3e-07 ref|XP_006370168.1| hypothetical protein POPTR_0001s40310g [Popu... 60 4e-07 ref|XP_002276519.1| PREDICTED: TPR repeat-containing thioredoxin... 59 9e-07 ref|XP_004171005.1| PREDICTED: LOW QUALITY PROTEIN: TPR repeat-c... 59 1e-06 ref|XP_004146029.1| PREDICTED: TPR repeat-containing thioredoxin... 59 1e-06 ref|XP_004489036.1| PREDICTED: TPR repeat-containing thioredoxin... 57 3e-06 >ref|XP_004244266.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Solanum lycopersicum] Length = 701 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/57 (63%), Positives = 45/57 (78%) Frame = +1 Query: 352 SQSGKAKPELGLSSLSDRLRNALTYEEEDNGVNVNKPDFRELDLGSPVSPLRTRNGG 522 S+SG+ E+GL ++DRL+N+LT E+ NGV +NKPDFRELDLGSPVSPLR R G Sbjct: 2 SESGRPMSEIGLDGVTDRLKNSLTCAEDGNGVEINKPDFRELDLGSPVSPLRNRPRG 58 >ref|XP_006348295.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Solanum tuberosum] Length = 700 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/57 (63%), Positives = 45/57 (78%) Frame = +1 Query: 352 SQSGKAKPELGLSSLSDRLRNALTYEEEDNGVNVNKPDFRELDLGSPVSPLRTRNGG 522 S+SG+ E+GL ++DRL+N+LT E+ NGV +NKPDFRELDLGSPVSPLR R G Sbjct: 2 SESGRHMSEIGLDGVTDRLKNSLTCVEDGNGVEINKPDFRELDLGSPVSPLRNRPRG 58 >gb|EPS72637.1| hypothetical protein M569_02119, partial [Genlisea aurea] Length = 684 Score = 67.8 bits (164), Expect = 2e-09 Identities = 38/62 (61%), Positives = 43/62 (69%), Gaps = 4/62 (6%) Frame = +1 Query: 352 SQSGKAKPELGLSSLSDRLRNALTYEEEDNGVNVNKPDFRELDLGSPVSPLRTRN----G 519 S SGK+KPELGL SLS R R +L E++N KPDFRELDLGSP+SPLR R G Sbjct: 1 SHSGKSKPELGLESLSGRFRASLACGEDEN-----KPDFRELDLGSPISPLRGRTAAAAG 55 Query: 520 GG 525 GG Sbjct: 56 GG 57 >gb|EMJ12561.1| hypothetical protein PRUPE_ppa002367mg [Prunus persica] Length = 680 Score = 67.0 bits (162), Expect = 3e-09 Identities = 36/58 (62%), Positives = 40/58 (68%) Frame = +1 Query: 352 SQSGKAKPELGLSSLSDRLRNALTYEEEDNGVNVNKPDFRELDLGSPVSPLRTRNGGG 525 S GK ELGL SL+DR R++L+ E NKPDFRELDLGSPVSPLRTR GG Sbjct: 2 SHPGKPISELGLDSLNDRFRDSLSCE-------ANKPDFRELDLGSPVSPLRTRQSGG 52 >gb|EXC18487.1| TPR repeat-containing thioredoxin TTL1 [Morus notabilis] Length = 689 Score = 63.2 bits (152), Expect = 5e-08 Identities = 35/54 (64%), Positives = 37/54 (68%) Frame = +1 Query: 352 SQSGKAKPELGLSSLSDRLRNALTYEEEDNGVNVNKPDFRELDLGSPVSPLRTR 513 S SGK ELGL SL DRL +L+ E NKPDFRELDLGSPVSPLRTR Sbjct: 2 SHSGKPVSELGLDSLGDRLAESLSCE-------ANKPDFRELDLGSPVSPLRTR 48 >ref|XP_006592931.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Glycine max] Length = 698 Score = 62.4 bits (150), Expect = 8e-08 Identities = 35/61 (57%), Positives = 45/61 (73%), Gaps = 3/61 (4%) Frame = +1 Query: 346 MSSQSGKAKPEL-GL-SSLSDRLRNALTYEE-EDNGVNVNKPDFRELDLGSPVSPLRTRN 516 MS SGK E+ G+ ++ +DR R+ALT ++ +N N+NKPDFRELDLGSPVSPLRT Sbjct: 1 MSRSSGKPVSEVVGIDATFADRFRDALTCDDGSNNNNNINKPDFRELDLGSPVSPLRTTR 60 Query: 517 G 519 G Sbjct: 61 G 61 >emb|CAN62839.1| hypothetical protein VITISV_003392 [Vitis vinifera] Length = 815 Score = 62.0 bits (149), Expect = 1e-07 Identities = 32/56 (57%), Positives = 39/56 (69%) Frame = +1 Query: 358 SGKAKPELGLSSLSDRLRNALTYEEEDNGVNVNKPDFRELDLGSPVSPLRTRNGGG 525 + K+ E+G+ SLSDR+R+ L+ E NKPDFRELDLGSPVSPL TR GG Sbjct: 4 TSKSIQEMGIDSLSDRVRDTLSCES-------NKPDFRELDLGSPVSPLMTRGSGG 52 >gb|EOY13241.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 4, partial [Theobroma cacao] Length = 628 Score = 61.6 bits (148), Expect = 1e-07 Identities = 35/58 (60%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +1 Query: 352 SQSGKAKPELG-LSSLSDRLRNALTYEEEDNGVNVNKPDFRELDLGSPVSPLRTRNGG 522 S GK ELG L L+D+LR++L+Y+ VNKPDFRELDLGSPVSPLRTR G Sbjct: 2 SHLGKPVTELGRLDKLADQLRDSLSYD-------VNKPDFRELDLGSPVSPLRTRQPG 52 >gb|EOY13240.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 3 [Theobroma cacao] Length = 656 Score = 61.6 bits (148), Expect = 1e-07 Identities = 35/58 (60%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +1 Query: 352 SQSGKAKPELG-LSSLSDRLRNALTYEEEDNGVNVNKPDFRELDLGSPVSPLRTRNGG 522 S GK ELG L L+D+LR++L+Y+ VNKPDFRELDLGSPVSPLRTR G Sbjct: 2 SHLGKPVTELGRLDKLADQLRDSLSYD-------VNKPDFRELDLGSPVSPLRTRQPG 52 >gb|EOY13239.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 2 [Theobroma cacao] Length = 696 Score = 61.6 bits (148), Expect = 1e-07 Identities = 35/58 (60%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +1 Query: 352 SQSGKAKPELG-LSSLSDRLRNALTYEEEDNGVNVNKPDFRELDLGSPVSPLRTRNGG 522 S GK ELG L L+D+LR++L+Y+ VNKPDFRELDLGSPVSPLRTR G Sbjct: 2 SHLGKPVTELGRLDKLADQLRDSLSYD-------VNKPDFRELDLGSPVSPLRTRQPG 52 >gb|EOY13238.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 1 [Theobroma cacao] Length = 698 Score = 61.6 bits (148), Expect = 1e-07 Identities = 35/58 (60%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +1 Query: 352 SQSGKAKPELG-LSSLSDRLRNALTYEEEDNGVNVNKPDFRELDLGSPVSPLRTRNGG 522 S GK ELG L L+D+LR++L+Y+ VNKPDFRELDLGSPVSPLRTR G Sbjct: 2 SHLGKPVTELGRLDKLADQLRDSLSYD-------VNKPDFRELDLGSPVSPLRTRQPG 52 >ref|XP_003541820.1| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Glycine max] Length = 692 Score = 61.6 bits (148), Expect = 1e-07 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 2/60 (3%) Frame = +1 Query: 346 MSSQSGKAKPEL-GL-SSLSDRLRNALTYEEEDNGVNVNKPDFRELDLGSPVSPLRTRNG 519 MS SGK E+ G+ ++ SDR R+ALT ++ +N +NKPDFRELDLGSPVSPLRT G Sbjct: 1 MSHSSGKPVSEVVGIDATFSDRFRDALTCDDNNN---INKPDFRELDLGSPVSPLRTTRG 57 >ref|XP_004294076.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Fragaria vesca subsp. vesca] Length = 658 Score = 61.2 bits (147), Expect = 2e-07 Identities = 36/60 (60%), Positives = 39/60 (65%), Gaps = 2/60 (3%) Frame = +1 Query: 352 SQSGKAKPELG--LSSLSDRLRNALTYEEEDNGVNVNKPDFRELDLGSPVSPLRTRNGGG 525 S SGK E G + SLSDRLR +L+ E NKPDFRELDLGSPVSPLRT GG Sbjct: 2 SHSGKPISETGGGVDSLSDRLRESLSCE-------ANKPDFRELDLGSPVSPLRTHQSGG 54 >ref|XP_002283097.2| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Vitis vinifera] Length = 656 Score = 60.5 bits (145), Expect = 3e-07 Identities = 31/57 (54%), Positives = 37/57 (64%) Frame = +1 Query: 352 SQSGKAKPELGLSSLSDRLRNALTYEEEDNGVNVNKPDFRELDLGSPVSPLRTRNGG 522 S SGK E+GL +++DR R L + NKPDF+ELDLGSPVSPLRTR G Sbjct: 2 SHSGKPMSEVGLGAVADRFRETLNCDN-------NKPDFKELDLGSPVSPLRTRRSG 51 >emb|CBI20201.3| unnamed protein product [Vitis vinifera] Length = 645 Score = 60.5 bits (145), Expect = 3e-07 Identities = 31/57 (54%), Positives = 37/57 (64%) Frame = +1 Query: 352 SQSGKAKPELGLSSLSDRLRNALTYEEEDNGVNVNKPDFRELDLGSPVSPLRTRNGG 522 S SGK E+GL +++DR R L + NKPDF+ELDLGSPVSPLRTR G Sbjct: 2 SHSGKPMSEVGLGAVADRFRETLNCDN-------NKPDFKELDLGSPVSPLRTRRSG 51 >ref|XP_006370168.1| hypothetical protein POPTR_0001s40310g [Populus trichocarpa] gi|550349347|gb|ERP66737.1| hypothetical protein POPTR_0001s40310g [Populus trichocarpa] Length = 688 Score = 60.1 bits (144), Expect = 4e-07 Identities = 33/55 (60%), Positives = 40/55 (72%), Gaps = 4/55 (7%) Frame = +1 Query: 367 AKPELG----LSSLSDRLRNALTYEEEDNGVNVNKPDFRELDLGSPVSPLRTRNG 519 AKP +G LSSL+D+LR++L+ + NKPDFRELDLGSPVSPLRTR G Sbjct: 5 AKPSIGGDLDLSSLTDQLRDSLS------SLEANKPDFRELDLGSPVSPLRTRGG 53 >ref|XP_002276519.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Vitis vinifera] Length = 710 Score = 58.9 bits (141), Expect = 9e-07 Identities = 30/49 (61%), Positives = 35/49 (71%) Frame = +1 Query: 379 LGLSSLSDRLRNALTYEEEDNGVNVNKPDFRELDLGSPVSPLRTRNGGG 525 +G+ SLSDR+R+ L+ E NKPDFRELDLGSPVSPL TR GG Sbjct: 1 MGIDSLSDRVRDTLSCES-------NKPDFRELDLGSPVSPLMTRGSGG 42 >ref|XP_004171005.1| PREDICTED: LOW QUALITY PROTEIN: TPR repeat-containing thioredoxin TTL1-like [Cucumis sativus] Length = 698 Score = 58.5 bits (140), Expect = 1e-06 Identities = 34/60 (56%), Positives = 40/60 (66%), Gaps = 2/60 (3%) Frame = +1 Query: 352 SQSGKAKPELGLSSLSDRLRNALTYEEEDNGVNVNKPDFRELDLGSPVSPLRTRN--GGG 525 S SG +L LSDR R++++ E VNKPDFRELDLGSPVSPLRTR+ GGG Sbjct: 2 SHSGNPISDLRFDHLSDRFRDSVSCE-------VNKPDFRELDLGSPVSPLRTRHQTGGG 54 >ref|XP_004146029.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Cucumis sativus] Length = 698 Score = 58.5 bits (140), Expect = 1e-06 Identities = 34/60 (56%), Positives = 40/60 (66%), Gaps = 2/60 (3%) Frame = +1 Query: 352 SQSGKAKPELGLSSLSDRLRNALTYEEEDNGVNVNKPDFRELDLGSPVSPLRTRN--GGG 525 S SG +L LSDR R++++ E VNKPDFRELDLGSPVSPLRTR+ GGG Sbjct: 2 SHSGNPISDLRFDHLSDRFRDSVSCE-------VNKPDFRELDLGSPVSPLRTRHQTGGG 54 >ref|XP_004489036.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Cicer arietinum] Length = 691 Score = 57.4 bits (137), Expect = 3e-06 Identities = 33/59 (55%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = +1 Query: 346 MSSQSGKAKPEL-GLSSLSDRLRNALTYEEEDNGVNVNKPDFRELDLGSPVSPLRTRNG 519 MS S K + E+ GL SDR +++E VNKPDFRELDLGSPVSPLRTR G Sbjct: 1 MSHSSEKPESEVVGLEHFSDRFSEKVSFE-------VNKPDFRELDLGSPVSPLRTRGG 52