BLASTX nr result
ID: Rehmannia25_contig00028989
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00028989 (316 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ03663.1| hypothetical protein PRUPE_ppa010130mg [Prunus pe... 62 8e-08 ref|XP_002516502.1| Transcriptional factor TINY, putative [Ricin... 57 2e-06 gb|ADE41132.1| AP2 domain class transcription factor [Malus dome... 57 3e-06 gb|AHJ25971.1| dehydration responsive element binding transcript... 56 4e-06 gb|AHJ25980.1| dehydration responsive element binding transcript... 55 1e-05 >gb|EMJ03663.1| hypothetical protein PRUPE_ppa010130mg [Prunus persica] Length = 262 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -2 Query: 165 EELSEIVELPSLGSCFDSLELSNEFVYIDNTVVEGWLEPPPPW 37 EELSEIVELPSLG+ ++S E NEFV++D+ VEGWL PPP W Sbjct: 179 EELSEIVELPSLGTSYESAESGNEFVFVDS--VEGWLYPPPWW 219 >ref|XP_002516502.1| Transcriptional factor TINY, putative [Ricinus communis] gi|223544322|gb|EEF45843.1| Transcriptional factor TINY, putative [Ricinus communis] Length = 270 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 6/57 (10%) Frame = -2 Query: 165 EELSEIVELPSLGSCFDSLELSNEFVYIDNTVVEGWLEPPPPW------GAGGVADD 13 EELSEIVELPSLG+ ++S EL ++FVY+D+ V+GW+ PPPW G GG D Sbjct: 188 EELSEIVELPSLGTSYESSELRSDFVYVDS--VDGWVY-PPPWLEESHVGGGGCLFD 241 >gb|ADE41132.1| AP2 domain class transcription factor [Malus domestica] Length = 278 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/53 (50%), Positives = 37/53 (69%) Frame = -2 Query: 165 EELSEIVELPSLGSCFDSLELSNEFVYIDNTVVEGWLEPPPPWGAGGVADDGG 7 EEL EIV+LPSLG+ ++S E +EFV+ D+ VEGWL PPP W + ++ G Sbjct: 194 EELGEIVKLPSLGTSYESAESGSEFVFADS--VEGWLYPPPWWHNSYLEEENG 244 >gb|AHJ25971.1| dehydration responsive element binding transcription factor [Morus notabilis] gi|587870508|gb|EXB59791.1| Dehydration-responsive element-binding protein 3 [Morus notabilis] Length = 267 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/50 (52%), Positives = 34/50 (68%) Frame = -2 Query: 165 EELSEIVELPSLGSCFDSLELSNEFVYIDNTVVEGWLEPPPPWGAGGVAD 16 EELSEIV+LPSLG+ ++S E +EFV++D+ WL PPP W G D Sbjct: 188 EELSEIVKLPSLGTSYESPESGSEFVFVDSVDCGTWLYPPPAWYNEGFED 237 >gb|AHJ25980.1| dehydration responsive element binding transcription factor [Morus notabilis] gi|587905190|gb|EXB93375.1| Dehydration-responsive element-binding protein 3 [Morus notabilis] Length = 249 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = -2 Query: 165 EELSEIVELPSLGSCFDSLELSNEFVYIDNTVVEGWLEPPP 43 EELSEIVELPSLG+ ++S EL EFV++D+ +GW+ PPP Sbjct: 188 EELSEIVELPSLGTSYESAELGTEFVFVDSE--DGWVYPPP 226