BLASTX nr result
ID: Rehmannia25_contig00028858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00028858 (522 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004253029.1| PREDICTED: LETM1 and EF-hand domain-containi... 74 3e-11 ref|XP_006342418.1| PREDICTED: LETM1 and EF-hand domain-containi... 73 5e-11 >ref|XP_004253029.1| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial-like [Solanum lycopersicum] Length = 747 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/68 (51%), Positives = 51/68 (75%) Frame = +3 Query: 309 MASRVILRRRKILSDYLNVHVRSIQSIQTLGDGQSCQCFDSRGYTSITDSISQNSDQLRE 488 MASR ILRRR++LSDYLNV RSIQ++++ G+GQS FDS G++S + I Q D+ ++ Sbjct: 1 MASRAILRRRRLLSDYLNVSARSIQNLRSWGNGQSAHYFDSCGFSSTANCICQGLDKRKD 60 Query: 489 NDETSALS 512 +DE S ++ Sbjct: 61 HDEVSPIN 68 >ref|XP_006342418.1| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial-like [Solanum tuberosum] Length = 747 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/68 (51%), Positives = 50/68 (73%) Frame = +3 Query: 309 MASRVILRRRKILSDYLNVHVRSIQSIQTLGDGQSCQCFDSRGYTSITDSISQNSDQLRE 488 MASR I RRR++LSDYLNV RSIQ++Q+ G+GQS FD G++S + I Q SD+ ++ Sbjct: 1 MASRAIQRRRRLLSDYLNVSARSIQNLQSWGNGQSAHYFDPCGFSSTMNCICQGSDKRKD 60 Query: 489 NDETSALS 512 +DE S ++ Sbjct: 61 HDEVSPIN 68