BLASTX nr result
ID: Rehmannia25_contig00028631
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00028631 (499 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277091.1| PREDICTED: frataxin, mitochondrial isoform 1... 69 8e-10 emb|CAN67530.1| hypothetical protein VITISV_004311 [Vitis vinifera] 69 8e-10 ref|XP_004293478.1| PREDICTED: frataxin, mitochondrial-like [Fra... 65 7e-09 gb|EOX99241.1| Frataxin [Theobroma cacao] 64 2e-08 gb|EMJ18471.1| hypothetical protein PRUPE_ppa011940mg [Prunus pe... 64 2e-08 ref|XP_006447426.1| hypothetical protein CICLE_v10016814mg [Citr... 62 6e-08 ref|XP_004493241.1| PREDICTED: frataxin, mitochondrial-like [Cic... 62 1e-07 ref|XP_004139965.1| PREDICTED: frataxin, mitochondrial-like [Cuc... 62 1e-07 ref|XP_003520940.1| PREDICTED: frataxin, mitochondrial-like [Gly... 62 1e-07 ref|XP_002531340.1| Frataxin, mitochondrial precursor, putative ... 61 1e-07 ref|XP_006360538.1| PREDICTED: frataxin, mitochondrial-like [Sol... 61 2e-07 ref|XP_004243423.1| PREDICTED: frataxin, mitochondrial-like [Sol... 61 2e-07 ref|XP_003554058.1| PREDICTED: frataxin, mitochondrial-like [Gly... 61 2e-07 ref|XP_002872789.1| hypothetical protein ARALYDRAFT_490236 [Arab... 60 2e-07 ref|XP_003619909.1| Frataxin-like protein [Medicago truncatula] ... 60 3e-07 ref|XP_003619899.1| Frataxin-like protein [Medicago truncatula] ... 60 3e-07 gb|EXB62335.1| Frataxin [Morus notabilis] 59 7e-07 ref|XP_006288733.1| hypothetical protein CARUB_v10002050mg [Caps... 59 9e-07 ref|NP_192233.2| frataxin [Arabidopsis thaliana] gi|83302740|sp|... 59 9e-07 gb|AAD14452.1| putative frataxin-like protein [Arabidopsis thali... 59 9e-07 >ref|XP_002277091.1| PREDICTED: frataxin, mitochondrial isoform 1 [Vitis vinifera] gi|296081250|emb|CBI17994.3| unnamed protein product [Vitis vinifera] Length = 197 Score = 68.6 bits (166), Expect = 8e-10 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = +1 Query: 1 RFDWDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 117 RFDWDQ AQAW+YRRTK NL +LETELEKLC PISLS Sbjct: 159 RFDWDQSAQAWVYRRTKANLSKLLETELEKLCGTPISLS 197 >emb|CAN67530.1| hypothetical protein VITISV_004311 [Vitis vinifera] Length = 202 Score = 68.6 bits (166), Expect = 8e-10 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = +1 Query: 1 RFDWDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 117 RFDWDQ AQAW+YRRTK NL +LETELEKLC PISLS Sbjct: 164 RFDWDQSAQAWVYRRTKANLSKLLETELEKLCGTPISLS 202 >ref|XP_004293478.1| PREDICTED: frataxin, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 187 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +1 Query: 1 RFDWDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 117 RFDWD+DA+AWIYRRTK L+ +LETE+E+LC +PISLS Sbjct: 149 RFDWDRDAEAWIYRRTKVKLLTLLETEMEQLCGEPISLS 187 >gb|EOX99241.1| Frataxin [Theobroma cacao] Length = 184 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = +1 Query: 1 RFDWDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 117 RFDWD +AQAW+YRRTK NL+ +LE+ELEKLC +P+++S Sbjct: 146 RFDWDFNAQAWVYRRTKANLLKLLESELEKLCGEPVNIS 184 >gb|EMJ18471.1| hypothetical protein PRUPE_ppa011940mg [Prunus persica] Length = 190 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/39 (66%), Positives = 36/39 (92%) Frame = +1 Query: 1 RFDWDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 117 RFDWD++AQAW+YRRTK +L+ +LE+E+E+LC +PISLS Sbjct: 152 RFDWDRNAQAWVYRRTKAHLLKLLESEMEELCGEPISLS 190 >ref|XP_006447426.1| hypothetical protein CICLE_v10016814mg [Citrus clementina] gi|567910227|ref|XP_006447427.1| hypothetical protein CICLE_v10016814mg [Citrus clementina] gi|567910229|ref|XP_006447428.1| hypothetical protein CICLE_v10016814mg [Citrus clementina] gi|568831055|ref|XP_006469796.1| PREDICTED: frataxin, mitochondrial-like isoform X1 [Citrus sinensis] gi|568831057|ref|XP_006469797.1| PREDICTED: frataxin, mitochondrial-like isoform X2 [Citrus sinensis] gi|568831059|ref|XP_006469798.1| PREDICTED: frataxin, mitochondrial-like isoform X3 [Citrus sinensis] gi|557550037|gb|ESR60666.1| hypothetical protein CICLE_v10016814mg [Citrus clementina] gi|557550038|gb|ESR60667.1| hypothetical protein CICLE_v10016814mg [Citrus clementina] gi|557550039|gb|ESR60668.1| hypothetical protein CICLE_v10016814mg [Citrus clementina] Length = 196 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = +1 Query: 1 RFDWDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 117 RFDWD AQ W+YRRTK NL+ +LE+ELE+LC +PI+LS Sbjct: 155 RFDWDTGAQGWVYRRTKANLLKLLESELEQLCGEPINLS 193 >ref|XP_004493241.1| PREDICTED: frataxin, mitochondrial-like [Cicer arietinum] Length = 186 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +1 Query: 1 RFDWDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 117 RFDWDQD +AWIYRR K L +LE ELE+LC KPI LS Sbjct: 148 RFDWDQDTKAWIYRRNKAKLYKILEVELEQLCGKPIVLS 186 >ref|XP_004139965.1| PREDICTED: frataxin, mitochondrial-like [Cucumis sativus] Length = 191 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +1 Query: 1 RFDWDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 117 RFDWDQ++Q WIYRR K NL+ +LETEL +LC +PI LS Sbjct: 153 RFDWDQNSQTWIYRRNKANLLSLLETELTQLCGEPIDLS 191 >ref|XP_003520940.1| PREDICTED: frataxin, mitochondrial-like [Glycine max] Length = 191 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +1 Query: 1 RFDWDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 117 RFDWD+D +AWIYRR K NL +LE ELE+LC KPI LS Sbjct: 153 RFDWDRDTKAWIYRRNKANLYKILEGELEQLCGKPIVLS 191 >ref|XP_002531340.1| Frataxin, mitochondrial precursor, putative [Ricinus communis] gi|223529062|gb|EEF31047.1| Frataxin, mitochondrial precursor, putative [Ricinus communis] Length = 200 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/39 (61%), Positives = 34/39 (87%) Frame = +1 Query: 1 RFDWDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 117 R+DWD++A+AW+YRRTK NL VLE+ELE++C +PI L+ Sbjct: 162 RYDWDRNAEAWVYRRTKANLFEVLESELEQVCGEPIKLA 200 >ref|XP_006360538.1| PREDICTED: frataxin, mitochondrial-like [Solanum tuberosum] Length = 194 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = +1 Query: 1 RFDWDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 117 RFDWDQ +Q WIYRRTK NL VLE ELEKLC I+LS Sbjct: 156 RFDWDQSSQGWIYRRTKANLQKVLEDELEKLCGSAINLS 194 >ref|XP_004243423.1| PREDICTED: frataxin, mitochondrial-like [Solanum lycopersicum] Length = 194 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = +1 Query: 1 RFDWDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 117 RFDWDQ +Q WIYRRTK NL VLE ELEKLC I+LS Sbjct: 156 RFDWDQSSQGWIYRRTKANLQKVLEDELEKLCGSAITLS 194 >ref|XP_003554058.1| PREDICTED: frataxin, mitochondrial-like [Glycine max] Length = 191 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = +1 Query: 1 RFDWDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 117 RFDWD+D +AWIYRR K NL +LE E E+LC KPI LS Sbjct: 153 RFDWDRDTKAWIYRRNKANLYKILEGEFEQLCGKPIDLS 191 >ref|XP_002872789.1| hypothetical protein ARALYDRAFT_490236 [Arabidopsis lyrata subsp. lyrata] gi|297318626|gb|EFH49048.1| hypothetical protein ARALYDRAFT_490236 [Arabidopsis lyrata subsp. lyrata] Length = 186 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +1 Query: 1 RFDWDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 117 RFDWD+DA AWIYRRT+ L +LE ELEKLC +PI LS Sbjct: 148 RFDWDRDANAWIYRRTEAKLHKLLEEELEKLCGEPIQLS 186 >ref|XP_003619909.1| Frataxin-like protein [Medicago truncatula] gi|355494924|gb|AES76127.1| Frataxin-like protein [Medicago truncatula] Length = 54 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +1 Query: 1 RFDWDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 117 RFDWDQ +AWIYRR K NL +LE ELE+LC KPI LS Sbjct: 16 RFDWDQVTKAWIYRRNKANLYKILEDELEQLCGKPIVLS 54 >ref|XP_003619899.1| Frataxin-like protein [Medicago truncatula] gi|355494914|gb|AES76117.1| Frataxin-like protein [Medicago truncatula] Length = 188 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +1 Query: 1 RFDWDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 117 RFDWDQ +AWIYRR K NL +LE ELE+LC KPI LS Sbjct: 150 RFDWDQVTKAWIYRRNKANLYKILEDELEQLCGKPIVLS 188 >gb|EXB62335.1| Frataxin [Morus notabilis] Length = 196 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = +1 Query: 1 RFDWDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 117 RFDWD AQAWIYRR K NL+ +LE E+++LC +P++LS Sbjct: 158 RFDWDPSAQAWIYRRNKANLLKLLEREMKQLCGEPLNLS 196 >ref|XP_006288733.1| hypothetical protein CARUB_v10002050mg [Capsella rubella] gi|482557439|gb|EOA21631.1| hypothetical protein CARUB_v10002050mg [Capsella rubella] Length = 186 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = +1 Query: 1 RFDWDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 117 RFDWD+DA AWIYRRT+ L +LE ELE LC +PI LS Sbjct: 148 RFDWDRDANAWIYRRTEAKLHKLLEEELENLCGEPIQLS 186 >ref|NP_192233.2| frataxin [Arabidopsis thaliana] gi|83302740|sp|Q9ZR07.2|FRDA_ARATH RecName: Full=Frataxin, mitochondrial; Short=Fxn; Flags: Precursor gi|48958525|gb|AAT47815.1| At4g03240 [Arabidopsis thaliana] gi|51860727|gb|AAU11485.1| mitochondrial frataxin-like [Arabidopsis thaliana] gi|51971038|dbj|BAD44211.1| putative frataxin-like protein [Arabidopsis thaliana] gi|51971859|dbj|BAD44594.1| putative frataxin-like protein [Arabidopsis thaliana] gi|332656896|gb|AEE82296.1| frataxin [Arabidopsis thaliana] Length = 187 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = +1 Query: 1 RFDWDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 117 RFDWD+DA AWIYRRT+ L +LE ELE LC +PI LS Sbjct: 149 RFDWDRDANAWIYRRTEAKLHKLLEEELENLCGEPIQLS 187 >gb|AAD14452.1| putative frataxin-like protein [Arabidopsis thaliana] gi|7270194|emb|CAB77809.1| putative frataxin-like protein [Arabidopsis thaliana] Length = 143 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = +1 Query: 1 RFDWDQDAQAWIYRRTKQNLIHVLETELEKLCEKPISLS 117 RFDWD+DA AWIYRRT+ L +LE ELE LC +PI LS Sbjct: 105 RFDWDRDANAWIYRRTEAKLHKLLEEELENLCGEPIQLS 143