BLASTX nr result
ID: Rehmannia25_contig00028604
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00028604 (332 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI25982.3| unnamed protein product [Vitis vinifera] 59 9e-07 >emb|CBI25982.3| unnamed protein product [Vitis vinifera] Length = 539 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/46 (63%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Frame = -2 Query: 331 GEDVPAPFMTFEATGFPPEILQEVRYLLQRRS-TCRTLQCYAHIYA 197 GE+VP P MTFEATGFPPEIL+EVRYLLQ+ +AHI+A Sbjct: 490 GENVPPPLMTFEATGFPPEILREVRYLLQKEEHMSYAALLFAHIHA 535