BLASTX nr result
ID: Rehmannia25_contig00028466
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00028466 (366 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006650183.1| PREDICTED: 60S ribosomal protein L27a-3-like... 56 6e-06 ref|XP_006648362.1| PREDICTED: 60S ribosomal protein L27a-3-like... 56 6e-06 >ref|XP_006650183.1| PREDICTED: 60S ribosomal protein L27a-3-like [Oryza brachyantha] Length = 146 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +2 Query: 152 ISRFVYLRFSAMKGLLPADKPVVVKAKLVSKNAEKKIKEAGGDV 283 +S+F Y + KGLLPAD+P+VVKAKL+SK AEKKIK AGG V Sbjct: 100 VSQFGYFKVLG-KGLLPADRPIVVKAKLISKVAEKKIKAAGGAV 142 >ref|XP_006648362.1| PREDICTED: 60S ribosomal protein L27a-3-like [Oryza brachyantha] Length = 172 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +2 Query: 152 ISRFVYLRFSAMKGLLPADKPVVVKAKLVSKNAEKKIKEAGGDV 283 +S+F Y + KGLLPAD+P+VVKAKL+SK AEKKIK AGG V Sbjct: 126 VSQFGYFKVLG-KGLLPADRPIVVKAKLISKVAEKKIKAAGGAV 168