BLASTX nr result
ID: Rehmannia25_contig00028291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00028291 (458 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEQ29024.1| WRKY28 [Panax quinquefolius] 57 2e-06 >gb|AEQ29024.1| WRKY28 [Panax quinquefolius] Length = 316 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/60 (51%), Positives = 42/60 (70%), Gaps = 4/60 (6%) Frame = +2 Query: 224 EQKSSLGFIDMSSIQDFSNPCSIFDDLLQNITAPLIPTIQA----PEYSEVVNTPATPNN 391 +QKSSLGF+++ IQD++N SIFD L + +AP P QA + SEV+NTPATPN+ Sbjct: 33 DQKSSLGFMELLGIQDYNNTSSIFDILREEHSAPPPPAGQASTNPADSSEVLNTPATPNS 92