BLASTX nr result
ID: Rehmannia25_contig00027893
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00027893 (521 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS66800.1| hypothetical protein M569_07974, partial [Genlise... 57 3e-06 emb|CAI11457.1| putative glycosyltransferase [Solanum tuberosum] 55 1e-05 >gb|EPS66800.1| hypothetical protein M569_07974, partial [Genlisea aurea] Length = 449 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/47 (68%), Positives = 35/47 (74%), Gaps = 3/47 (6%) Frame = +3 Query: 390 MGSESTFSAQKRTSSALPTT---VNGGARGRPASFLPRGRQINNKTF 521 MGSE FSAQKRTS+ LPT+ GG RGR AS LPRGRQI +KTF Sbjct: 1 MGSEGAFSAQKRTSTVLPTSSAAAKGGNRGRTASVLPRGRQI-HKTF 46 >emb|CAI11457.1| putative glycosyltransferase [Solanum tuberosum] Length = 474 Score = 55.1 bits (131), Expect = 1e-05 Identities = 32/46 (69%), Positives = 36/46 (78%), Gaps = 2/46 (4%) Frame = +3 Query: 390 MGSESTFSAQKRTSSALPTTV--NGGARGRPASFLPRGRQINNKTF 521 MG ESTF+AQKR + ALPTTV NGG RGR + LPRGRQI N+TF Sbjct: 1 MGQESTFTAQKR-AGALPTTVTANGGVRGRSPNVLPRGRQI-NRTF 44