BLASTX nr result
ID: Rehmannia25_contig00027804
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00027804 (380 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67944.1| hypothetical protein M569_06828, partial [Genlise... 58 2e-06 >gb|EPS67944.1| hypothetical protein M569_06828, partial [Genlisea aurea] Length = 375 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/47 (57%), Positives = 32/47 (68%) Frame = +3 Query: 240 RDNCSSANGLPPIPNSLGGRGGAYRHCLNPDGTPPLCTKSLIRHPSL 380 RD+CSS NG PPIPNS G G YR CL+ +G LCT L+RH +L Sbjct: 3 RDSCSSGNGRPPIPNSFGS-GTPYRKCLDANGALKLCTTPLVRHQAL 48