BLASTX nr result
ID: Rehmannia25_contig00027579
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00027579 (514 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279458.1| PREDICTED: F-box protein At4g18380-like [Vit... 57 3e-06 >ref|XP_002279458.1| PREDICTED: F-box protein At4g18380-like [Vitis vinifera] Length = 341 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/54 (53%), Positives = 38/54 (70%) Frame = -1 Query: 220 GITSQIDRLPDDVITRHVFDKISDPKSLFNCSLVSKRFASLVPDTQIVSLNIPS 59 G DRL D+++T +F+K+ D KSL CS+VSKRFASL+P T VSL +PS Sbjct: 6 GPDDHFDRLSDELVTL-IFNKVLDAKSLCRCSVVSKRFASLIPQTDNVSLIVPS 58