BLASTX nr result
ID: Rehmannia25_contig00027307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00027307 (357 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515994.1| Cytochrome c oxidase assembly protein COX19,... 57 3e-06 >ref|XP_002515994.1| Cytochrome c oxidase assembly protein COX19, putative [Ricinus communis] gi|223544899|gb|EEF46414.1| Cytochrome c oxidase assembly protein COX19, putative [Ricinus communis] Length = 94 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 3 YLECRMEKNLMAKQDMSELGFRKEVELQAS 92 YLECRMEKNLMA+QDMSELGFRKE +L+AS Sbjct: 59 YLECRMEKNLMARQDMSELGFRKEPDLEAS 88