BLASTX nr result
ID: Rehmannia25_contig00026856
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00026856 (314 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAY73580.1| hypothetical protein OsI_01464 [Oryza sativa Indi... 79 8e-13 ref|XP_006428345.1| hypothetical protein CICLE_v10013710mg, part... 77 2e-12 gb|AAV88601.1| low temperature and salt responsive protein [Cenc... 77 2e-12 ref|XP_006658870.1| PREDICTED: pentatricopeptide repeat-containi... 77 3e-12 ref|XP_003555775.2| PREDICTED: hydrophobic protein LTI6A [Glycin... 77 3e-12 ref|XP_004967634.1| PREDICTED: hydrophobic protein LTI6B-like is... 77 3e-12 ref|NP_001151840.1| hydrophobic protein LTI6B [Zea mays] gi|2269... 77 3e-12 ref|NP_001147508.1| LOC100281117 [Zea mays] gi|195611860|gb|ACG2... 76 4e-12 ref|XP_004967635.1| PREDICTED: hydrophobic protein LTI6B-like is... 76 5e-12 ref|XP_004494506.1| PREDICTED: hydrophobic protein LTI6B-like [C... 76 5e-12 gb|ACA66247.1| cold-induced plasma membrane protein [Musa ABB Gr... 76 5e-12 gb|ABK22915.1| unknown [Picea sitchensis] gi|116790796|gb|ABK257... 76 5e-12 ref|XP_004967637.1| PREDICTED: hydrophobic protein LTI6B-like is... 75 7e-12 ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citr... 75 9e-12 ref|XP_002512586.1| Hydrophobic protein LTI6A, putative [Ricinus... 75 9e-12 ref|NP_001147403.1| hydrophobic protein LTI6A [Zea mays] gi|1956... 75 9e-12 ref|NP_001152633.1| hydrophobic protein LTI6A [Zea mays] gi|1946... 75 9e-12 ref|XP_004958446.1| PREDICTED: hydrophobic protein LTI6A-like [S... 75 1e-11 ref|NP_001060390.1| Os07g0635900 [Oryza sativa Japonica Group] g... 74 2e-11 gb|ADV02768.1| putative low temperature and salt responsive prot... 74 2e-11 >gb|EAY73580.1| hypothetical protein OsI_01464 [Oryza sativa Indica Group] gi|222618224|gb|EEE54356.1| hypothetical protein OsJ_01354 [Oryza sativa Japonica Group] Length = 56 Score = 78.6 bits (192), Expect = 8e-13 Identities = 32/39 (82%), Positives = 39/39 (100%) Frame = +3 Query: 81 MADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 197 M+DGTANC+DI++AI+LPPLGVFLKFGC+VEFW+CLLLT Sbjct: 1 MSDGTANCIDILIAIILPPLGVFLKFGCKVEFWLCLLLT 39 >ref|XP_006428345.1| hypothetical protein CICLE_v10013710mg, partial [Citrus clementina] gi|557530402|gb|ESR41585.1| hypothetical protein CICLE_v10013710mg, partial [Citrus clementina] Length = 104 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/45 (77%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = +3 Query: 66 KKEKKMADG-TANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 197 K + KMADG TA CVDI+LA++LPPLGVFLKFGC+ EFWICLLLT Sbjct: 42 KNQSKMADGSTATCVDILLAVILPPLGVFLKFGCKAEFWICLLLT 86 >gb|AAV88601.1| low temperature and salt responsive protein [Cenchrus americanus] Length = 56 Score = 77.0 bits (188), Expect = 2e-12 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +3 Query: 81 MADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 197 M+DGTANC+DIILAI+LPPLGVF KFGC VEFWICL+LT Sbjct: 1 MSDGTANCIDIILAIILPPLGVFFKFGCGVEFWICLVLT 39 >ref|XP_006658870.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Oryza brachyantha] Length = 678 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +3 Query: 75 KKMADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 197 +KMAD TA C+DIILAI+LPPLGVF KFGC +EFWICLLLT Sbjct: 621 EKMADSTATCIDIILAIILPPLGVFFKFGCGIEFWICLLLT 661 >ref|XP_003555775.2| PREDICTED: hydrophobic protein LTI6A [Glycine max] Length = 104 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/49 (71%), Positives = 42/49 (85%), Gaps = 1/49 (2%) Frame = +3 Query: 54 KYQIKKEKKMA-DGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 197 K + +E KMA DG A C+DI+LAI+LPPLGVFLK+GCQVEFWICL+LT Sbjct: 39 KLRKSRETKMAGDGAATCIDILLAIILPPLGVFLKYGCQVEFWICLVLT 87 >ref|XP_004967634.1| PREDICTED: hydrophobic protein LTI6B-like isoform X1 [Setaria italica] Length = 57 Score = 76.6 bits (187), Expect = 3e-12 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = +3 Query: 81 MADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 197 M +GTANCVDI++AI+LPPLGVFLKFGC+VEFW+CLLLT Sbjct: 1 MKEGTANCVDILIAIILPPLGVFLKFGCKVEFWLCLLLT 39 >ref|NP_001151840.1| hydrophobic protein LTI6B [Zea mays] gi|226958659|ref|NP_001152948.1| hydrophobic protein LTI6B [Zea mays] gi|195648282|gb|ACG43609.1| hydrophobic protein LTI6B [Zea mays] gi|195650163|gb|ACG44549.1| hydrophobic protein LTI6B [Zea mays] gi|414877124|tpg|DAA54255.1| TPA: hydrophobic protein LTI6B [Zea mays] Length = 57 Score = 76.6 bits (187), Expect = 3e-12 Identities = 32/39 (82%), Positives = 38/39 (97%) Frame = +3 Query: 81 MADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 197 M +GTANCVDI++AI+LPPLGVFLKFGC+VEFW+CLLLT Sbjct: 1 MKEGTANCVDILIAIILPPLGVFLKFGCKVEFWLCLLLT 39 >ref|NP_001147508.1| LOC100281117 [Zea mays] gi|195611860|gb|ACG27760.1| hydrophobic protein LTI6B [Zea mays] gi|413946837|gb|AFW79486.1| hydrophobic protein LTI6B [Zea mays] Length = 57 Score = 76.3 bits (186), Expect = 4e-12 Identities = 31/39 (79%), Positives = 38/39 (97%) Frame = +3 Query: 81 MADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 197 M +GTANC+DI++AI+LPPLGVFLKFGC+VEFW+CLLLT Sbjct: 1 MKEGTANCIDILIAIILPPLGVFLKFGCKVEFWLCLLLT 39 >ref|XP_004967635.1| PREDICTED: hydrophobic protein LTI6B-like isoform X2 [Setaria italica] gi|514773012|ref|XP_004967636.1| PREDICTED: hydrophobic protein LTI6B-like isoform X3 [Setaria italica] Length = 56 Score = 75.9 bits (185), Expect = 5e-12 Identities = 31/39 (79%), Positives = 38/39 (97%) Frame = +3 Query: 81 MADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 197 M++GTANC+DI++AI+LPPLGVFLKFGC+ EFWICLLLT Sbjct: 1 MSEGTANCIDILIAIILPPLGVFLKFGCKFEFWICLLLT 39 >ref|XP_004494506.1| PREDICTED: hydrophobic protein LTI6B-like [Cicer arietinum] Length = 57 Score = 75.9 bits (185), Expect = 5e-12 Identities = 35/40 (87%), Positives = 38/40 (95%), Gaps = 1/40 (2%) Frame = +3 Query: 81 MAD-GTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 197 MAD GTANC+DI+LAILLPPLGVFLKFGC VEFWICL+LT Sbjct: 1 MADEGTANCIDILLAILLPPLGVFLKFGCHVEFWICLVLT 40 >gb|ACA66247.1| cold-induced plasma membrane protein [Musa ABB Group] Length = 57 Score = 75.9 bits (185), Expect = 5e-12 Identities = 34/40 (85%), Positives = 39/40 (97%), Gaps = 1/40 (2%) Frame = +3 Query: 81 MAD-GTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 197 MAD GTANC+DI+LAI+LPPLGVFLKFGC++EFWICLLLT Sbjct: 1 MADKGTANCIDILLAIILPPLGVFLKFGCEMEFWICLLLT 40 >gb|ABK22915.1| unknown [Picea sitchensis] gi|116790796|gb|ABK25743.1| unknown [Picea sitchensis] gi|306015593|gb|ADM76850.1| low temprature induced-like protein [Picea sitchensis] gi|306015595|gb|ADM76851.1| low temprature induced-like protein [Picea sitchensis] gi|306015597|gb|ADM76852.1| low temprature induced-like protein [Picea sitchensis] gi|306015599|gb|ADM76853.1| low temprature induced-like protein [Picea sitchensis] gi|306015601|gb|ADM76854.1| low temprature induced-like protein [Picea sitchensis] gi|306015603|gb|ADM76855.1| low temprature induced-like protein [Picea sitchensis] gi|306015605|gb|ADM76856.1| low temprature induced-like protein [Picea sitchensis] gi|306015607|gb|ADM76857.1| low temprature induced-like protein [Picea sitchensis] gi|306015609|gb|ADM76858.1| low temprature induced-like protein [Picea sitchensis] gi|306015611|gb|ADM76859.1| low temprature induced-like protein [Picea sitchensis] gi|306015613|gb|ADM76860.1| low temprature induced-like protein [Picea sitchensis] gi|306015615|gb|ADM76861.1| low temprature induced-like protein [Picea sitchensis] gi|306015617|gb|ADM76862.1| low temprature induced-like protein [Picea sitchensis] gi|306015619|gb|ADM76863.1| low temprature induced-like protein [Picea sitchensis] gi|306015621|gb|ADM76864.1| low temprature induced-like protein [Picea sitchensis] gi|306015623|gb|ADM76865.1| low temprature induced-like protein [Picea sitchensis] gi|306015625|gb|ADM76866.1| low temprature induced-like protein [Picea sitchensis] gi|306015627|gb|ADM76867.1| low temprature induced-like protein [Picea sitchensis] gi|306015629|gb|ADM76868.1| low temprature induced-like protein [Picea sitchensis] gi|306015631|gb|ADM76869.1| low temprature induced-like protein [Picea sitchensis] gi|306015633|gb|ADM76870.1| low temprature induced-like protein [Picea sitchensis] gi|306015635|gb|ADM76871.1| low temprature induced-like protein [Picea sitchensis] gi|306015637|gb|ADM76872.1| low temprature induced-like protein [Picea sitchensis] gi|306015639|gb|ADM76873.1| low temprature induced-like protein [Picea sitchensis] gi|306015641|gb|ADM76874.1| low temprature induced-like protein [Picea sitchensis] gi|306015643|gb|ADM76875.1| low temprature induced-like protein [Picea sitchensis] gi|306015645|gb|ADM76876.1| low temprature induced-like protein [Picea sitchensis] gi|306015647|gb|ADM76877.1| low temprature induced-like protein [Picea sitchensis] gi|306015649|gb|ADM76878.1| low temprature induced-like protein [Picea sitchensis] gi|306015651|gb|ADM76879.1| low temprature induced-like protein [Picea sitchensis] gi|306015653|gb|ADM76880.1| low temprature induced-like protein [Picea sitchensis] gi|306015655|gb|ADM76881.1| low temprature induced-like protein [Picea sitchensis] gi|306015657|gb|ADM76882.1| low temprature induced-like protein [Picea sitchensis] gi|306015659|gb|ADM76883.1| low temprature induced-like protein [Picea sitchensis] gi|306015661|gb|ADM76884.1| low temprature induced-like protein [Picea sitchensis] gi|306015663|gb|ADM76885.1| low temprature induced-like protein [Picea sitchensis] gi|306015665|gb|ADM76886.1| low temprature induced-like protein [Picea sitchensis] gi|306015667|gb|ADM76887.1| low temprature induced-like protein [Picea sitchensis] gi|306015669|gb|ADM76888.1| low temprature induced-like protein [Picea sitchensis] gi|306015671|gb|ADM76889.1| low temprature induced-like protein [Picea sitchensis] gi|306015673|gb|ADM76890.1| low temprature induced-like protein [Picea sitchensis] gi|306015675|gb|ADM76891.1| low temprature induced-like protein [Picea sitchensis] gi|306015677|gb|ADM76892.1| low temprature induced-like protein [Picea sitchensis] gi|306015679|gb|ADM76893.1| low temprature induced-like protein [Picea sitchensis] gi|306015681|gb|ADM76894.1| low temprature induced-like protein [Picea sitchensis] gi|306015683|gb|ADM76895.1| low temprature induced-like protein [Picea sitchensis] Length = 59 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +3 Query: 81 MADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 197 M +GTANCVDIILAI+LPP+GVFLKFGC EFWICLLLT Sbjct: 1 MREGTANCVDIILAIILPPVGVFLKFGCHAEFWICLLLT 39 >ref|XP_004967637.1| PREDICTED: hydrophobic protein LTI6B-like isoform X4 [Setaria italica] Length = 56 Score = 75.5 bits (184), Expect = 7e-12 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +3 Query: 81 MADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 197 M +GTANCVDI++AI+LPPLGVFLKFGC+ EFWICLLLT Sbjct: 1 MKEGTANCVDILIAIILPPLGVFLKFGCKFEFWICLLLT 39 >ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|567871515|ref|XP_006428347.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|568853386|ref|XP_006480340.1| PREDICTED: hydrophobic protein LTI6A-like [Citrus sinensis] gi|557530403|gb|ESR41586.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|557530404|gb|ESR41587.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] Length = 58 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/40 (87%), Positives = 38/40 (95%), Gaps = 1/40 (2%) Frame = +3 Query: 81 MAD-GTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 197 MAD GTA C+DIILAI+LPPLGVFLKFGC+VEFWICLLLT Sbjct: 1 MADEGTATCIDIILAIILPPLGVFLKFGCKVEFWICLLLT 40 >ref|XP_002512586.1| Hydrophobic protein LTI6A, putative [Ricinus communis] gi|223548547|gb|EEF50038.1| Hydrophobic protein LTI6A, putative [Ricinus communis] Length = 56 Score = 75.1 bits (183), Expect = 9e-12 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +3 Query: 81 MADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 197 MADG A C+DI+LAI+LPPLGVFLK+GC+VEFWICL+LT Sbjct: 1 MADGAATCIDILLAIILPPLGVFLKYGCKVEFWICLILT 39 >ref|NP_001147403.1| hydrophobic protein LTI6A [Zea mays] gi|195611068|gb|ACG27364.1| hydrophobic protein LTI6A [Zea mays] gi|195655849|gb|ACG47392.1| hydrophobic protein LTI6A [Zea mays] Length = 56 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +3 Query: 81 MADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 197 M+DGTA C+DIILAI+LPPLGVF KFGC VEFWICL+LT Sbjct: 1 MSDGTATCIDIILAIILPPLGVFFKFGCGVEFWICLILT 39 >ref|NP_001152633.1| hydrophobic protein LTI6A [Zea mays] gi|194693716|gb|ACF80942.1| unknown [Zea mays] gi|195606844|gb|ACG25252.1| hydrophobic protein LTI6A [Zea mays] gi|195658355|gb|ACG48645.1| hydrophobic protein LTI6A [Zea mays] gi|414887788|tpg|DAA63802.1| TPA: hydrophobic protein LTI6A [Zea mays] Length = 56 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +3 Query: 81 MADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 197 M+DGTA C+DIILAI+LPPLGVF KFGC VEFWICL+LT Sbjct: 1 MSDGTATCIDIILAIILPPLGVFFKFGCGVEFWICLILT 39 >ref|XP_004958446.1| PREDICTED: hydrophobic protein LTI6A-like [Setaria italica] Length = 56 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +3 Query: 81 MADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 197 M+DGTA C+DIILAI+LPPLGVF KFGC VEFWICL+LT Sbjct: 1 MSDGTATCIDIILAIILPPLGVFFKFGCGVEFWICLVLT 39 >ref|NP_001060390.1| Os07g0635900 [Oryza sativa Japonica Group] gi|73620937|sp|Q8H5T6.1|LTI6A_ORYSJ RecName: Full=Hydrophobic protein LTI6A; AltName: Full=Low temperature-induced protein 6A gi|23237810|dbj|BAC16385.1| putative low temperature and salt responsive protein [Oryza sativa Japonica Group] gi|45602863|gb|AAS72305.1| drought-induced hydrophobic protein [Oryza sativa Japonica Group] gi|47717899|gb|AAT37941.1| low temperature-induced low molecular weight integral membrane protein LTI6a [Oryza sativa Japonica Group] gi|113611926|dbj|BAF22304.1| Os07g0635900 [Oryza sativa Japonica Group] gi|125559297|gb|EAZ04833.1| hypothetical protein OsI_27011 [Oryza sativa Indica Group] gi|125601220|gb|EAZ40796.1| hypothetical protein OsJ_25274 [Oryza sativa Japonica Group] gi|149391025|gb|ABR25530.1| hydrophobic protein lti6b [Oryza sativa Indica Group] gi|215768082|dbj|BAH00311.1| unnamed protein product [Oryza sativa Japonica Group] Length = 56 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +3 Query: 81 MADGTANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 197 MAD TA C+DIILAI+LPPLGVF KFGC +EFWICLLLT Sbjct: 1 MADSTATCIDIILAIILPPLGVFFKFGCGIEFWICLLLT 39 >gb|ADV02768.1| putative low temperature and salt responsive protein isoform 1 [Ipomoea batatas] gi|317134413|gb|ADV02769.1| putative low temperature and salt responsive protein isoform 2 [Ipomoea batatas] Length = 57 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/40 (85%), Positives = 37/40 (92%), Gaps = 1/40 (2%) Frame = +3 Query: 81 MADG-TANCVDIILAILLPPLGVFLKFGCQVEFWICLLLT 197 MADG TA C+DI+LAI+LPPLGVFLKFGCQVEFWIC LLT Sbjct: 1 MADGSTATCIDILLAIILPPLGVFLKFGCQVEFWICCLLT 40