BLASTX nr result
ID: Rehmannia25_contig00026778
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00026778 (394 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003618126.1| Calcium-dependent protein kinase [Medicago t... 45 2e-08 gb|AGJ83811.1| calcium-dependent protein kinase 3d [Vitis amuren... 45 2e-08 ref|XP_002282994.1| PREDICTED: calcium-dependent protein kinase ... 45 2e-08 emb|CAN78387.1| hypothetical protein VITISV_017368 [Vitis vinifera] 45 2e-08 ref|XP_003618125.1| Calcium-dependent protein kinase [Medicago t... 45 2e-08 emb|CBI37730.3| unnamed protein product [Vitis vinifera] 45 2e-08 ref|XP_006412116.1| hypothetical protein EUTSA_v10024803mg [Eutr... 42 3e-08 ref|XP_004290076.1| PREDICTED: calcium-dependent protein kinase ... 45 4e-08 gb|ABY55551.1| calcium-dependent protein kinase [Swainsona canes... 45 4e-08 ref|XP_006422397.1| hypothetical protein CICLE_v10028110mg [Citr... 45 4e-08 gb|ADM88045.1| CDPK11 [Nicotiana tabacum] 45 6e-08 gb|AAW31900.1| calcium-dependent/calmodulin-independent protein ... 44 7e-08 gb|ADO79932.1| calcium-dependent protein kinase 10 [Nicotiana ta... 44 9e-08 ref|XP_004231103.1| PREDICTED: calcium-dependent protein kinase ... 44 9e-08 ref|NP_001274790.1| calcium-dependent protein kinase 5 [Solanum ... 44 9e-08 gb|AAZ32751.1| calcium dependent kinase 5 [Brassica oleracea var... 42 9e-08 ref|XP_004144896.1| PREDICTED: calcium-dependent protein kinase ... 45 1e-07 gb|ESW14571.1| hypothetical protein PHAVU_008G292500g [Phaseolus... 45 1e-07 ref|XP_002328137.1| calcium dependent protein kinase 6 [Populus ... 45 1e-07 gb|AAC49405.1| calcium dependent protein kinase [Vigna radiata] 45 1e-07 >ref|XP_003618126.1| Calcium-dependent protein kinase [Medicago truncatula] gi|355519461|gb|AET01085.1| Calcium-dependent protein kinase [Medicago truncatula] Length = 597 Score = 45.1 bits (105), Expect(2) = 2e-08 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -3 Query: 392 SGTIDYGKFIVARVHLNKLESEKHL 318 SGTIDYG+FI A VHLNKLE E+HL Sbjct: 488 SGTIDYGEFIAATVHLNKLEREEHL 512 Score = 38.9 bits (89), Expect(2) = 2e-08 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = -2 Query: 294 WMKVIRLEQACV*HIITGVFIDDIIKEVDQYN 199 ++ V L+QAC H +T VF++DIIKEVDQ N Sbjct: 526 YITVDELQQACTEHNMTDVFLEDIIKEVDQDN 557 >gb|AGJ83811.1| calcium-dependent protein kinase 3d [Vitis amurensis] Length = 561 Score = 45.1 bits (105), Expect(2) = 2e-08 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -3 Query: 392 SGTIDYGKFIVARVHLNKLESEKHL 318 SGTIDYG+FI A VHLNKLE E+HL Sbjct: 452 SGTIDYGEFIAATVHLNKLEREEHL 476 Score = 38.9 bits (89), Expect(2) = 2e-08 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = -2 Query: 294 WMKVIRLEQACV*HIITGVFIDDIIKEVDQYN 199 ++ V L+QAC H +T VF++DIIKEVDQ N Sbjct: 490 YITVDELQQACAEHNMTDVFLEDIIKEVDQDN 521 >ref|XP_002282994.1| PREDICTED: calcium-dependent protein kinase 4 [Vitis vinifera] Length = 561 Score = 45.1 bits (105), Expect(2) = 2e-08 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -3 Query: 392 SGTIDYGKFIVARVHLNKLESEKHL 318 SGTIDYG+FI A VHLNKLE E+HL Sbjct: 452 SGTIDYGEFIAATVHLNKLEREEHL 476 Score = 38.9 bits (89), Expect(2) = 2e-08 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = -2 Query: 294 WMKVIRLEQACV*HIITGVFIDDIIKEVDQYN 199 ++ V L+QAC H +T VF++DIIKEVDQ N Sbjct: 490 YITVDELQQACAEHNMTDVFLEDIIKEVDQDN 521 >emb|CAN78387.1| hypothetical protein VITISV_017368 [Vitis vinifera] Length = 561 Score = 45.1 bits (105), Expect(2) = 2e-08 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -3 Query: 392 SGTIDYGKFIVARVHLNKLESEKHL 318 SGTIDYG+FI A VHLNKLE E+HL Sbjct: 452 SGTIDYGEFIAATVHLNKLEREEHL 476 Score = 38.9 bits (89), Expect(2) = 2e-08 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = -2 Query: 294 WMKVIRLEQACV*HIITGVFIDDIIKEVDQYN 199 ++ V L+QAC H +T VF++DIIKEVDQ N Sbjct: 490 YITVDELQQACAEHNMTDVFLEDIIKEVDQDN 521 >ref|XP_003618125.1| Calcium-dependent protein kinase [Medicago truncatula] gi|355519460|gb|AET01084.1| Calcium-dependent protein kinase [Medicago truncatula] Length = 559 Score = 45.1 bits (105), Expect(2) = 2e-08 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -3 Query: 392 SGTIDYGKFIVARVHLNKLESEKHL 318 SGTIDYG+FI A VHLNKLE E+HL Sbjct: 450 SGTIDYGEFIAATVHLNKLEREEHL 474 Score = 38.9 bits (89), Expect(2) = 2e-08 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = -2 Query: 294 WMKVIRLEQACV*HIITGVFIDDIIKEVDQYN 199 ++ V L+QAC H +T VF++DIIKEVDQ N Sbjct: 488 YITVDELQQACTEHNMTDVFLEDIIKEVDQDN 519 >emb|CBI37730.3| unnamed protein product [Vitis vinifera] Length = 463 Score = 45.1 bits (105), Expect(2) = 2e-08 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -3 Query: 392 SGTIDYGKFIVARVHLNKLESEKHL 318 SGTIDYG+FI A VHLNKLE E+HL Sbjct: 354 SGTIDYGEFIAATVHLNKLEREEHL 378 Score = 38.9 bits (89), Expect(2) = 2e-08 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = -2 Query: 294 WMKVIRLEQACV*HIITGVFIDDIIKEVDQYN 199 ++ V L+QAC H +T VF++DIIKEVDQ N Sbjct: 392 YITVDELQQACAEHNMTDVFLEDIIKEVDQDN 423 >ref|XP_006412116.1| hypothetical protein EUTSA_v10024803mg [Eutrema salsugineum] gi|567216976|ref|XP_006412117.1| hypothetical protein EUTSA_v10024803mg [Eutrema salsugineum] gi|567216978|ref|XP_006412118.1| hypothetical protein EUTSA_v10024803mg [Eutrema salsugineum] gi|557113286|gb|ESQ53569.1| hypothetical protein EUTSA_v10024803mg [Eutrema salsugineum] gi|557113287|gb|ESQ53570.1| hypothetical protein EUTSA_v10024803mg [Eutrema salsugineum] gi|557113288|gb|ESQ53571.1| hypothetical protein EUTSA_v10024803mg [Eutrema salsugineum] Length = 563 Score = 42.4 bits (98), Expect(2) = 3e-08 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 392 SGTIDYGKFIVARVHLNKLESEKHL 318 SGTIDY +FI A +HLNKLE E+HL Sbjct: 457 SGTIDYSEFIAATIHLNKLEREEHL 481 Score = 40.8 bits (94), Expect(2) = 3e-08 Identities = 18/32 (56%), Positives = 25/32 (78%) Frame = -2 Query: 294 WMKVIRLEQACV*HIITGVFIDDIIKEVDQYN 199 ++ + L+QACV H +T VF++DIIKEVDQ N Sbjct: 495 YITIDELQQACVEHSMTDVFLEDIIKEVDQNN 526 >ref|XP_004290076.1| PREDICTED: calcium-dependent protein kinase 4-like [Fragaria vesca subsp. vesca] Length = 568 Score = 45.1 bits (105), Expect(2) = 4e-08 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -3 Query: 392 SGTIDYGKFIVARVHLNKLESEKHL 318 SGTIDYG+FI A VHLNKLE E+HL Sbjct: 455 SGTIDYGEFIAATVHLNKLEREEHL 479 Score = 37.7 bits (86), Expect(2) = 4e-08 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = -2 Query: 294 WMKVIRLEQACV*HIITGVFIDDIIKEVDQYN 199 ++ V L+QAC H IT V ++DIIKEVDQ N Sbjct: 493 YITVDELQQACAEHNITDVLLEDIIKEVDQDN 524 >gb|ABY55551.1| calcium-dependent protein kinase [Swainsona canescens] Length = 553 Score = 45.1 bits (105), Expect(2) = 4e-08 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -3 Query: 392 SGTIDYGKFIVARVHLNKLESEKHL 318 SGTIDYG+FI A VHLNKLE E+HL Sbjct: 444 SGTIDYGEFIAATVHLNKLEREEHL 468 Score = 37.7 bits (86), Expect(2) = 4e-08 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = -2 Query: 294 WMKVIRLEQACV*HIITGVFIDDIIKEVDQYN 199 ++ V L+QAC H +T VF++DII+EVDQ N Sbjct: 482 YITVDELQQACAEHNMTDVFLEDIIREVDQDN 513 >ref|XP_006422397.1| hypothetical protein CICLE_v10028110mg [Citrus clementina] gi|567859494|ref|XP_006422401.1| hypothetical protein CICLE_v10028110mg [Citrus clementina] gi|557524331|gb|ESR35637.1| hypothetical protein CICLE_v10028110mg [Citrus clementina] gi|557524335|gb|ESR35641.1| hypothetical protein CICLE_v10028110mg [Citrus clementina] Length = 537 Score = 45.1 bits (105), Expect(2) = 4e-08 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -3 Query: 392 SGTIDYGKFIVARVHLNKLESEKHL 318 SGTIDYG+FI A VHLNKLE E+HL Sbjct: 455 SGTIDYGEFIAATVHLNKLEREEHL 479 Score = 37.7 bits (86), Expect(2) = 4e-08 Identities = 22/45 (48%), Positives = 29/45 (64%), Gaps = 2/45 (4%) Frame = -2 Query: 294 WMKVIRLEQACV*HIITGVFIDDIIKEVDQYNVCDSS--*CCVLF 166 ++ V L+QAC H +T V ++DII+EVDQ NV S C VLF Sbjct: 493 YITVDELQQACAEHNMTDVLLEDIIREVDQDNVSCLSLITCFVLF 537 >gb|ADM88045.1| CDPK11 [Nicotiana tabacum] Length = 559 Score = 45.1 bits (105), Expect(2) = 6e-08 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -3 Query: 392 SGTIDYGKFIVARVHLNKLESEKHL 318 SGTIDYG+FI A VHLNKLE E+HL Sbjct: 449 SGTIDYGEFIAATVHLNKLEREEHL 473 Score = 37.4 bits (85), Expect(2) = 6e-08 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = -2 Query: 294 WMKVIRLEQACV*HIITGVFIDDIIKEVDQYN 199 ++ V ++QACV H IT V+ +DII+EVDQ N Sbjct: 487 YITVDEVQQACVEHNITDVYFEDIIREVDQDN 518 >gb|AAW31900.1| calcium-dependent/calmodulin-independent protein kinase [Panax ginseng] Length = 273 Score = 44.3 bits (103), Expect(2) = 7e-08 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = -3 Query: 392 SGTIDYGKFIVARVHLNKLESEKHL 318 SGTIDYG+F+ A +HLNKLE E+HL Sbjct: 190 SGTIDYGEFVAATIHLNKLEREEHL 214 Score = 37.7 bits (86), Expect(2) = 7e-08 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = -2 Query: 294 WMKVIRLEQACV*HIITGVFIDDIIKEVDQYN 199 ++ V L+QAC H +T VF++DII+EVDQ N Sbjct: 228 YITVDELQQACAEHNMTDVFLEDIIREVDQDN 259 >gb|ADO79932.1| calcium-dependent protein kinase 10 [Nicotiana tabacum] Length = 571 Score = 43.5 bits (101), Expect(2) = 9e-08 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = -3 Query: 392 SGTIDYGKFIVARVHLNKLESEKHL 318 SGTIDYG+FI A +HLNKL+ E+HL Sbjct: 462 SGTIDYGEFIAATIHLNKLDREEHL 486 Score = 38.1 bits (87), Expect(2) = 9e-08 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = -2 Query: 294 WMKVIRLEQACV*HIITGVFIDDIIKEVDQYN 199 ++ V L+QAC H IT VF +DII+EVDQ N Sbjct: 500 YITVDELQQACADHNITDVFFEDIIREVDQDN 531 >ref|XP_004231103.1| PREDICTED: calcium-dependent protein kinase 5-like [Solanum lycopersicum] Length = 535 Score = 43.5 bits (101), Expect(2) = 9e-08 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = -3 Query: 392 SGTIDYGKFIVARVHLNKLESEKHL 318 SGTIDYG+FI A +HLNKL+ E+HL Sbjct: 426 SGTIDYGEFIAATIHLNKLDREEHL 450 Score = 38.1 bits (87), Expect(2) = 9e-08 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = -2 Query: 294 WMKVIRLEQACV*HIITGVFIDDIIKEVDQYN 199 ++ V L+QAC H IT VF +DII+EVDQ N Sbjct: 464 YITVDELQQACADHNITDVFFEDIIREVDQDN 495 >ref|NP_001274790.1| calcium-dependent protein kinase 5 [Solanum tuberosum] gi|565397529|ref|XP_006364343.1| PREDICTED: calcium-dependent protein kinase 5-like isoform X1 [Solanum tuberosum] gi|565397531|ref|XP_006364344.1| PREDICTED: calcium-dependent protein kinase 5-like isoform X2 [Solanum tuberosum] gi|565397533|ref|XP_006364345.1| PREDICTED: calcium-dependent protein kinase 5-like isoform X3 [Solanum tuberosum] gi|565397535|ref|XP_006364346.1| PREDICTED: calcium-dependent protein kinase 5-like isoform X4 [Solanum tuberosum] gi|565397537|ref|XP_006364347.1| PREDICTED: calcium-dependent protein kinase 5-like isoform X5 [Solanum tuberosum] gi|166234052|sp|A5A7I8.1|CDPK5_SOLTU RecName: Full=Calcium-dependent protein kinase 5; Short=CDPK 5; Short=StCDPK5 gi|146219326|dbj|BAF57914.1| calcium-dependent protein kinases [Solanum tuberosum] Length = 535 Score = 43.5 bits (101), Expect(2) = 9e-08 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = -3 Query: 392 SGTIDYGKFIVARVHLNKLESEKHL 318 SGTIDYG+FI A +HLNKL+ E+HL Sbjct: 426 SGTIDYGEFIAATIHLNKLDREEHL 450 Score = 38.1 bits (87), Expect(2) = 9e-08 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = -2 Query: 294 WMKVIRLEQACV*HIITGVFIDDIIKEVDQYN 199 ++ V L+QAC H IT VF +DII+EVDQ N Sbjct: 464 YITVDELQQACADHNITDVFFEDIIREVDQDN 495 >gb|AAZ32751.1| calcium dependent kinase 5 [Brassica oleracea var. alboglabra] Length = 535 Score = 42.4 bits (98), Expect(2) = 9e-08 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 392 SGTIDYGKFIVARVHLNKLESEKHL 318 SGTIDY +FI A +HLNKLE E+HL Sbjct: 436 SGTIDYSEFIAATIHLNKLEREEHL 460 Score = 39.3 bits (90), Expect(2) = 9e-08 Identities = 17/32 (53%), Positives = 25/32 (78%) Frame = -2 Query: 294 WMKVIRLEQACV*HIITGVFIDDIIKEVDQYN 199 ++ + L+QACV H +T VF++DIIKEVD+ N Sbjct: 474 YITIDELQQACVEHSMTDVFLEDIIKEVDKNN 505 >ref|XP_004144896.1| PREDICTED: calcium-dependent protein kinase 4-like [Cucumis sativus] gi|449471982|ref|XP_004153460.1| PREDICTED: calcium-dependent protein kinase 4-like [Cucumis sativus] gi|449530458|ref|XP_004172212.1| PREDICTED: calcium-dependent protein kinase 4-like [Cucumis sativus] Length = 566 Score = 44.7 bits (104), Expect(2) = 1e-07 Identities = 19/25 (76%), Positives = 22/25 (88%) Frame = -3 Query: 392 SGTIDYGKFIVARVHLNKLESEKHL 318 SGTIDYG+FI A +HLNKLE E+HL Sbjct: 457 SGTIDYGEFIAATIHLNKLEREEHL 481 Score = 36.6 bits (83), Expect(2) = 1e-07 Identities = 16/32 (50%), Positives = 24/32 (75%) Frame = -2 Query: 294 WMKVIRLEQACV*HIITGVFIDDIIKEVDQYN 199 ++ V L+QAC H +T V+++DII+EVDQ N Sbjct: 495 YITVDELQQACAEHNMTDVYLEDIIREVDQDN 526 >gb|ESW14571.1| hypothetical protein PHAVU_008G292500g [Phaseolus vulgaris] Length = 562 Score = 45.1 bits (105), Expect(2) = 1e-07 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -3 Query: 392 SGTIDYGKFIVARVHLNKLESEKHL 318 SGTIDYG+FI A VHLNKLE E+HL Sbjct: 453 SGTIDYGEFIAATVHLNKLEREEHL 477 Score = 36.2 bits (82), Expect(2) = 1e-07 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = -2 Query: 294 WMKVIRLEQACV*HIITGVFIDDIIKEVDQYN 199 ++ V L+QAC H +T F++DII+EVDQ N Sbjct: 491 YITVDELQQACAEHNMTDAFLEDIIREVDQDN 522 >ref|XP_002328137.1| calcium dependent protein kinase 6 [Populus trichocarpa] gi|566167865|ref|XP_006384859.1| calcium-dependent/calmodulin-independent protein kinase [Populus trichocarpa] gi|550341627|gb|ERP62656.1| calcium-dependent/calmodulin-independent protein kinase [Populus trichocarpa] Length = 560 Score = 44.7 bits (104), Expect(2) = 1e-07 Identities = 19/25 (76%), Positives = 22/25 (88%) Frame = -3 Query: 392 SGTIDYGKFIVARVHLNKLESEKHL 318 SGTIDYG+F+ A VHLNKLE E+HL Sbjct: 451 SGTIDYGEFVAATVHLNKLEREEHL 475 Score = 36.6 bits (83), Expect(2) = 1e-07 Identities = 17/32 (53%), Positives = 23/32 (71%) Frame = -2 Query: 294 WMKVIRLEQACV*HIITGVFIDDIIKEVDQYN 199 ++ V L+QAC H +T V ++DIIKEVDQ N Sbjct: 489 YITVDELQQACAEHNMTDVLLEDIIKEVDQDN 520 >gb|AAC49405.1| calcium dependent protein kinase [Vigna radiata] Length = 487 Score = 45.1 bits (105), Expect(2) = 1e-07 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -3 Query: 392 SGTIDYGKFIVARVHLNKLESEKHL 318 SGTIDYG+FI A VHLNKLE E+HL Sbjct: 378 SGTIDYGEFIAATVHLNKLEREEHL 402 Score = 36.2 bits (82), Expect(2) = 1e-07 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = -2 Query: 294 WMKVIRLEQACV*HIITGVFIDDIIKEVDQYN 199 ++ V L+QAC H +T F++DII+EVDQ N Sbjct: 416 YITVDELQQACAEHNMTDAFLEDIIREVDQDN 447