BLASTX nr result
ID: Rehmannia25_contig00026776
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00026776 (558 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006381443.1| hypothetical protein POPTR_0006s12890g [Popu... 64 3e-08 gb|EXC16204.1| hypothetical protein L484_024375 [Morus notabilis] 60 5e-07 gb|EMJ07400.1| hypothetical protein PRUPE_ppa014907mg, partial [... 56 7e-06 ref|XP_006428760.1| hypothetical protein CICLE_v10013303mg [Citr... 55 9e-06 >ref|XP_006381443.1| hypothetical protein POPTR_0006s12890g [Populus trichocarpa] gi|550336146|gb|ERP59240.1| hypothetical protein POPTR_0006s12890g [Populus trichocarpa] Length = 77 Score = 63.9 bits (154), Expect = 3e-08 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +1 Query: 196 MGYIVVVSLPVILFFLITAIACYLFGRARGRQENVRLPQYY 318 MGY+V+VSLPVILF LI A+A YL GRARGR E R+PQY+ Sbjct: 1 MGYVVIVSLPVILFILIVALAFYLLGRARGRSEAARIPQYH 41 >gb|EXC16204.1| hypothetical protein L484_024375 [Morus notabilis] Length = 61 Score = 59.7 bits (143), Expect = 5e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +1 Query: 196 MGYIVVVSLPVILFFLITAIACYLFGRARGRQENVRLPQYY 318 MGYIVV+S+PVILF LI A+A YL GRARGR + +PQYY Sbjct: 1 MGYIVVLSVPVILFILIVALAFYLLGRARGRSQAESVPQYY 41 >gb|EMJ07400.1| hypothetical protein PRUPE_ppa014907mg, partial [Prunus persica] Length = 98 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +1 Query: 193 KMGYIVVVSLPVILFFLITAIACYLFGRARGRQENVRLPQYY 318 KMGY+VVVS+PVILF +I A+A YL GRA GR+E V Q++ Sbjct: 40 KMGYVVVVSVPVILFIVIVALAFYLIGRANGRREAVSAQQHF 81 >ref|XP_006428760.1| hypothetical protein CICLE_v10013303mg [Citrus clementina] gi|557530817|gb|ESR42000.1| hypothetical protein CICLE_v10013303mg [Citrus clementina] Length = 57 Score = 55.5 bits (132), Expect = 9e-06 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = +1 Query: 196 MGYIVVVSLPVILFFLITAIACYLFGRARGRQENVRLPQYY 318 M YIV VSLP ILF LI A+A YL GR RGR + R+PQYY Sbjct: 1 MVYIVEVSLPFILFILIVALAFYLLGRYRGRSQAARMPQYY 41