BLASTX nr result
ID: Rehmannia25_contig00026681
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00026681 (316 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABW98674.1| chloroplast tocopherol cyclase [Sesamum indicum] 64 2e-08 >gb|ABW98674.1| chloroplast tocopherol cyclase [Sesamum indicum] Length = 494 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/60 (56%), Positives = 43/60 (71%) Frame = +3 Query: 135 MENVSTIANNPCFNPLTTPLKTASGLPFSPAELRFRKKSQGLFAVKSVLKADSINSSIVN 314 ME+++ +AN PCFN L P K A+ L FS ELRF KK + FAVKSV ADSI+SS+V+ Sbjct: 1 MESLAAMANCPCFNSLMIPHKAAARLQFSAPELRFGKKFRHPFAVKSVFGADSISSSLVD 60