BLASTX nr result
ID: Rehmannia25_contig00026576
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00026576 (309 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS64821.1| hypothetical protein M569_09957, partial [Genlise... 57 2e-06 gb|ESW34593.1| hypothetical protein PHAVU_001G164800g [Phaseolus... 56 6e-06 ref|XP_002272086.1| PREDICTED: uncharacterized protein LOC100265... 55 1e-05 >gb|EPS64821.1| hypothetical protein M569_09957, partial [Genlisea aurea] Length = 187 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = +3 Query: 3 EILIMEALLHVPENEKKEQTFRISISDNIPLDCKPCVASRPQPSGSAQENQP 158 EILIMEALLHVP NE K QTFRIS+ D+ P + C+A PQ S +A+ QP Sbjct: 137 EILIMEALLHVPGNESKAQTFRISVMDSQPSENTACLACIPQTS-TAENLQP 187 >gb|ESW34593.1| hypothetical protein PHAVU_001G164800g [Phaseolus vulgaris] Length = 194 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/50 (52%), Positives = 36/50 (72%) Frame = +3 Query: 3 EILIMEALLHVPENEKKEQTFRISISDNIPLDCKPCVASRPQPSGSAQEN 152 +ILIM+ALLHVP NE++ +T RI++ DN PL C C S P PS +++ N Sbjct: 141 DILIMDALLHVPGNEERHRTLRINLVDN-PLSCTACTESTPHPSENSKAN 189 >ref|XP_002272086.1| PREDICTED: uncharacterized protein LOC100265138 isoform 1 [Vitis vinifera] gi|297744223|emb|CBI37193.3| unnamed protein product [Vitis vinifera] Length = 191 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/46 (60%), Positives = 33/46 (71%), Gaps = 4/46 (8%) Frame = +3 Query: 3 EILIMEALLHVPENEKKEQTFRISISDNI----PLDCKPCVASRPQ 128 EILIMEALLHVP NE+K+QTFRIS+ DN+ P C C A R + Sbjct: 141 EILIMEALLHVPANEEKQQTFRISLLDNLSTPAPKACTDCQAQRSE 186