BLASTX nr result
ID: Rehmannia25_contig00026461
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00026461 (580 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS59092.1| hypothetical protein M569_15720, partial [Genlise... 65 1e-08 >gb|EPS59092.1| hypothetical protein M569_15720, partial [Genlisea aurea] Length = 179 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/81 (39%), Positives = 54/81 (66%), Gaps = 1/81 (1%) Frame = -3 Query: 446 QDSVHGMKLHSAMVNQLKEQYDQKNKELEAKKRKGKEIEAVLESSPVH-ISEERLNQFNM 270 + SV G ++H +V QLKE+ D+K + L +KRKG+E+ +L +SP ISEE L +M Sbjct: 90 ESSVQGTRIHGLVVQQLKEELDEKKERLMDQKRKGREVSELLRNSPQQIISEESLRLLDM 149 Query: 269 HQLEQLKQKMEKLRDDVRRMV 207 +L++L+ + KL++D+ + V Sbjct: 150 PRLKKLRGALVKLKEDILQQV 170