BLASTX nr result
ID: Rehmannia25_contig00026158
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00026158 (381 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS58776.1| hypothetical protein M569_16037, partial [Genlise... 57 3e-06 >gb|EPS58776.1| hypothetical protein M569_16037, partial [Genlisea aurea] Length = 352 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +3 Query: 249 MESEIPSKSTLWKQSSMAPEKDYEDIDDLEGEHEDGDVGDIDP 377 ME+ P+K TLW+QSSMA ++DYE + DL+ E ED DV DIDP Sbjct: 1 METGAPAKFTLWRQSSMASDRDYEALIDLDLEQEDPDVADIDP 43