BLASTX nr result
ID: Rehmannia25_contig00026093
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00026093 (397 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285500.2| PREDICTED: uncharacterized protein At3g49720... 59 7e-07 ref|XP_006356828.1| PREDICTED: uncharacterized protein At3g49720... 57 3e-06 gb|EXC04274.1| hypothetical protein L484_002205 [Morus notabilis] 56 4e-06 >ref|XP_002285500.2| PREDICTED: uncharacterized protein At3g49720-like [Vitis vinifera] gi|302142150|emb|CBI19353.3| unnamed protein product [Vitis vinifera] Length = 263 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/60 (41%), Positives = 37/60 (61%) Frame = +3 Query: 210 TRRPTNPSRRVSESGTAPXXXXXXXXXXXXPYLSVALIVLGALFVVGFLYRGQGSFGNYK 389 +R+P NPSRR + SGT P P+LS+ L+++GA+ ++G+ Y G GSFG K Sbjct: 2 SRKPVNPSRRFAGSGTLPFIGSLHSKSRASPFLSIGLLIMGAMLLIGYSYSGSGSFGGNK 61 >ref|XP_006356828.1| PREDICTED: uncharacterized protein At3g49720-like [Solanum tuberosum] Length = 263 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/62 (38%), Positives = 38/62 (61%) Frame = +3 Query: 204 MATRRPTNPSRRVSESGTAPXXXXXXXXXXXXPYLSVALIVLGALFVVGFLYRGQGSFGN 383 M +RRP NPSRRV+++G + PYL++ LI++GA ++G+ YR G+F + Sbjct: 1 MMSRRPINPSRRVADNGASSLEGSIRSKTRSPPYLTIGLIIVGAFLLIGYFYRDTGTFAS 60 Query: 384 YK 389 K Sbjct: 61 IK 62 >gb|EXC04274.1| hypothetical protein L484_002205 [Morus notabilis] Length = 261 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/62 (40%), Positives = 37/62 (59%) Frame = +3 Query: 210 TRRPTNPSRRVSESGTAPXXXXXXXXXXXXPYLSVALIVLGALFVVGFLYRGQGSFGNYK 389 +RR NP+RR+++SG+ P P LSV L+VLGA+ ++G+ Y G G N + Sbjct: 2 SRRQVNPARRIADSGSIPFVGSVQSKTRSSPLLSVVLVVLGAILIIGYCYSGSGGASNIE 61 Query: 390 AV 395 AV Sbjct: 62 AV 63