BLASTX nr result
ID: Rehmannia25_contig00025617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00025617 (469 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006348427.1| PREDICTED: uncharacterized protein LOC102594... 55 7e-06 ref|XP_004228917.1| PREDICTED: uncharacterized protein LOC101264... 55 7e-06 >ref|XP_006348427.1| PREDICTED: uncharacterized protein LOC102594000 [Solanum tuberosum] Length = 159 Score = 55.5 bits (132), Expect = 7e-06 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 2/46 (4%) Frame = -2 Query: 180 MPRQIVLRAPPS-AVDRR-QPLLQSSDYSSRGGTRTVRVAEVAGGT 49 M +QIVLRAP S ++DRR QPLL + D SSRGG R R+AEVAGGT Sbjct: 1 MTKQIVLRAPSSLSIDRRRQPLLSNQDTSSRGGVRKARLAEVAGGT 46 >ref|XP_004228917.1| PREDICTED: uncharacterized protein LOC101264148 [Solanum lycopersicum] Length = 159 Score = 55.5 bits (132), Expect = 7e-06 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 2/46 (4%) Frame = -2 Query: 180 MPRQIVLRAPPS-AVDRR-QPLLQSSDYSSRGGTRTVRVAEVAGGT 49 M +QIVLRAP S ++DRR QPLL + D SSRGG R R+AEVAGGT Sbjct: 1 MTKQIVLRAPSSLSIDRRRQPLLSNQDTSSRGGVRKARLAEVAGGT 46