BLASTX nr result
ID: Rehmannia25_contig00025546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00025546 (645 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006351442.1| PREDICTED: BTB/POZ and TAZ domain-containing... 59 9e-07 ref|XP_004236301.1| PREDICTED: BTB/POZ and TAZ domain-containing... 59 9e-07 gb|EOY22321.1| BTB and TAZ domain protein 2 isoform 3, partial [... 58 3e-06 gb|EOY22320.1| BTB and TAZ domain protein 2 isoform 2 [Theobroma... 58 3e-06 gb|EOY22319.1| BTB and TAZ domain protein 2 isoform 1 [Theobroma... 58 3e-06 ref|XP_006347420.1| PREDICTED: BTB/POZ and TAZ domain-containing... 57 5e-06 ref|XP_004241529.1| PREDICTED: BTB/POZ and TAZ domain-containing... 57 5e-06 gb|EMJ10388.1| hypothetical protein PRUPE_ppa006416mg [Prunus pe... 57 6e-06 >ref|XP_006351442.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum tuberosum] Length = 345 Score = 59.3 bits (142), Expect = 9e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 644 KRMWQLFKLHSSICDQPDECRVPLCR 567 KRMWQL +LHSSICDQPDECRVPLCR Sbjct: 260 KRMWQLLRLHSSICDQPDECRVPLCR 285 >ref|XP_004236301.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum lycopersicum] Length = 345 Score = 59.3 bits (142), Expect = 9e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 644 KRMWQLFKLHSSICDQPDECRVPLCR 567 KRMWQL +LHSSICDQPDECRVPLCR Sbjct: 260 KRMWQLLRLHSSICDQPDECRVPLCR 285 >gb|EOY22321.1| BTB and TAZ domain protein 2 isoform 3, partial [Theobroma cacao] Length = 253 Score = 57.8 bits (138), Expect = 3e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -2 Query: 644 KRMWQLFKLHSSICDQPDECRVPLCRYINI 555 KRMWQL +LHSSICDQPD CRVPLCR + Sbjct: 169 KRMWQLLRLHSSICDQPDSCRVPLCRQFKL 198 >gb|EOY22320.1| BTB and TAZ domain protein 2 isoform 2 [Theobroma cacao] Length = 334 Score = 57.8 bits (138), Expect = 3e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -2 Query: 644 KRMWQLFKLHSSICDQPDECRVPLCRYINI 555 KRMWQL +LHSSICDQPD CRVPLCR + Sbjct: 250 KRMWQLLRLHSSICDQPDSCRVPLCRQFKL 279 >gb|EOY22319.1| BTB and TAZ domain protein 2 isoform 1 [Theobroma cacao] Length = 354 Score = 57.8 bits (138), Expect = 3e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -2 Query: 644 KRMWQLFKLHSSICDQPDECRVPLCRYINI 555 KRMWQL +LHSSICDQPD CRVPLCR + Sbjct: 270 KRMWQLLRLHSSICDQPDSCRVPLCRQFKL 299 >ref|XP_006347420.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum tuberosum] Length = 349 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = -2 Query: 644 KRMWQLFKLHSSICDQPDECRVPLCR 567 KRMWQL +LH+SICDQPD+CRVPLCR Sbjct: 267 KRMWQLLRLHASICDQPDDCRVPLCR 292 >ref|XP_004241529.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum lycopersicum] Length = 333 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = -2 Query: 644 KRMWQLFKLHSSICDQPDECRVPLCR 567 KRMWQL +LH+SICDQPD+CRVPLCR Sbjct: 251 KRMWQLLRLHASICDQPDDCRVPLCR 276 >gb|EMJ10388.1| hypothetical protein PRUPE_ppa006416mg [Prunus persica] Length = 413 Score = 56.6 bits (135), Expect = 6e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -2 Query: 644 KRMWQLFKLHSSICDQPDECRVPLCRYINI 555 KRMWQL +LHSS+CDQPD CRVPLCR + Sbjct: 330 KRMWQLLRLHSSMCDQPDSCRVPLCRQFKL 359