BLASTX nr result
ID: Rehmannia25_contig00025302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00025302 (431 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67236.1| hypothetical protein M569_07539, partial [Genlise... 79 8e-13 >gb|EPS67236.1| hypothetical protein M569_07539, partial [Genlisea aurea] Length = 525 Score = 78.6 bits (192), Expect = 8e-13 Identities = 42/86 (48%), Positives = 50/86 (58%), Gaps = 1/86 (1%) Frame = -1 Query: 257 MRRPNARTVNPNLEENK-DMDPIKFHSRPTRPGFXXXXXXXXXXXXRFCLYTSISIALVL 81 MRR NAR PNL++ MDP+K R +R GF RFC Y SISI VL Sbjct: 1 MRRSNARIAKPNLDDGSAGMDPVKLQFRSSRAGFRSPNSRFAKTRSRFCFYISISIPFVL 60 Query: 80 FCYILFFGNKNRENKKYGVVIDGGST 3 F YI FF + + +K+Y VVIDGGST Sbjct: 61 FFYIFFFRGRGQVSKRYSVVIDGGST 86