BLASTX nr result
ID: Rehmannia25_contig00025289
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00025289 (994 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ17432.1| hypothetical protein PRUPE_ppa016833mg, partial [... 65 3e-08 gb|EMJ08140.1| hypothetical protein PRUPE_ppb017081mg, partial [... 62 3e-07 gb|EPS63383.1| hypothetical protein M569_11401 [Genlisea aurea] 60 1e-06 emb|CAN77450.1| hypothetical protein VITISV_016971 [Vitis vinifera] 60 1e-06 >gb|EMJ17432.1| hypothetical protein PRUPE_ppa016833mg, partial [Prunus persica] Length = 449 Score = 65.5 bits (158), Expect = 3e-08 Identities = 25/53 (47%), Positives = 41/53 (77%) Frame = +3 Query: 834 TPPINMNLISWNCRGLGNPRTIHELRDIVRTKLPHLIFLCETKCHSSVIEKIK 992 TPP MNL+SWNC+GLG P T++ L+ ++R ++P ++FLC+T+C + + K+K Sbjct: 13 TPPGTMNLLSWNCQGLGIPWTVNGLKCVIRREVPKVVFLCKTRCSKAHMAKVK 65 >gb|EMJ08140.1| hypothetical protein PRUPE_ppb017081mg, partial [Prunus persica] Length = 577 Score = 62.0 bits (149), Expect = 3e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = +3 Query: 849 MNLISWNCRGLGNPRTIHELRDIVRTKLPHLIFLCETKCHS 971 +N++SWN RGLGNPRT L D++R K PH+IFL ETKC S Sbjct: 335 LNILSWNVRGLGNPRTFRALNDLLREKNPHVIFLMETKCTS 375 >gb|EPS63383.1| hypothetical protein M569_11401 [Genlisea aurea] Length = 1469 Score = 60.1 bits (144), Expect = 1e-06 Identities = 25/52 (48%), Positives = 37/52 (71%) Frame = +3 Query: 837 PPINMNLISWNCRGLGNPRTIHELRDIVRTKLPHLIFLCETKCHSSVIEKIK 992 PP M+L++WNCRGL + T+ LRD++ + P +IFL ETKC +S +E +K Sbjct: 365 PPSAMSLLAWNCRGLRSASTVRRLRDVISSDAPSMIFLSETKCLASHVEWLK 416 >emb|CAN77450.1| hypothetical protein VITISV_016971 [Vitis vinifera] Length = 652 Score = 60.1 bits (144), Expect = 1e-06 Identities = 30/55 (54%), Positives = 38/55 (69%) Frame = +3 Query: 828 LPTPPINMNLISWNCRGLGNPRTIHELRDIVRTKLPHLIFLCETKCHSSVIEKIK 992 LPT I ISWNCRGLGNPRT+ L +I +++ P IFL ET HS+ +EK+K Sbjct: 303 LPTAMIG---ISWNCRGLGNPRTVLALCEINKSRKPDFIFLIETLVHSAQVEKLK 354