BLASTX nr result
ID: Rehmannia25_contig00025062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00025062 (410 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC27870.1| hypothetical protein L484_009192 [Morus notabilis] 64 2e-08 >gb|EXC27870.1| hypothetical protein L484_009192 [Morus notabilis] Length = 94 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/63 (46%), Positives = 36/63 (57%), Gaps = 5/63 (7%) Frame = +3 Query: 195 ILWRAIVHVECWSVWLERNNRIFYESEETSLECWD-----ISSWVKGNKEFKHLFVSDLT 359 +LW+ + W +WLERN RIF EE S+ WD I+ W+ NKEF L SDL Sbjct: 29 VLWKVAMMAIWWRIWLERNRRIFERREEDSIITWDRIKLNIALWIHSNKEFCDLLYSDLV 88 Query: 360 RDW 368 RDW Sbjct: 89 RDW 91