BLASTX nr result
ID: Rehmannia25_contig00024682
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00024682 (607 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004243183.1| PREDICTED: interactor of constitutive active... 81 3e-13 ref|XP_006348373.1| PREDICTED: interactor of constitutive active... 80 4e-13 gb|ESW21315.1| hypothetical protein PHAVU_005G060700g [Phaseolus... 79 7e-13 gb|EMJ15095.1| hypothetical protein PRUPE_ppa007058mg [Prunus pe... 79 7e-13 emb|CBI32925.3| unnamed protein product [Vitis vinifera] 76 8e-12 gb|EOY13689.1| Interactor of constitutive active rops 1 isoform ... 74 2e-11 ref|XP_003543151.1| PREDICTED: interactor of constitutive active... 74 2e-11 ref|XP_003546766.1| PREDICTED: interactor of constitutive active... 74 4e-11 ref|XP_004488646.1| PREDICTED: interactor of constitutive active... 73 7e-11 gb|EXB52700.1| hypothetical protein L484_022477 [Morus notabilis] 72 9e-11 ref|XP_004294109.1| PREDICTED: interactor of constitutive active... 72 9e-11 gb|EOY13690.1| Interactor of constitutive active rops 1 isoform ... 71 2e-10 ref|XP_006477921.1| PREDICTED: interactor of constitutive active... 70 3e-10 ref|XP_006442245.1| hypothetical protein CICLE_v10020573mg [Citr... 70 3e-10 ref|XP_002271827.2| PREDICTED: interactor of constitutive active... 69 8e-10 emb|CAN73256.1| hypothetical protein VITISV_002134 [Vitis vinifera] 69 8e-10 ref|XP_004487468.1| PREDICTED: interactor of constitutive active... 66 6e-09 ref|XP_002300426.2| hypothetical protein POPTR_0001s38710g [Popu... 61 3e-07 ref|XP_002530129.1| conserved hypothetical protein [Ricinus comm... 60 6e-07 ref|XP_004251832.1| PREDICTED: interactor of constitutive active... 58 2e-06 >ref|XP_004243183.1| PREDICTED: interactor of constitutive active ROPs 4-like isoform 1 [Solanum lycopersicum] gi|460395222|ref|XP_004243184.1| PREDICTED: interactor of constitutive active ROPs 4-like isoform 2 [Solanum lycopersicum] Length = 370 Score = 80.9 bits (198), Expect = 3e-13 Identities = 41/64 (64%), Positives = 50/64 (78%), Gaps = 1/64 (1%) Frame = +1 Query: 418 MRRSRVTEISQRQSPRGPPSLRTSSSDSDHVHPRPRTERTPKLAEGRA-RGTQSDPSNQK 594 M RSR +E+ QRQSPR P LRTSSS+SD +H RP T+R+PKL + R+ RG QSDP NQ+ Sbjct: 1 MPRSRGSEMPQRQSPRAPSQLRTSSSESDPIHHRPVTDRSPKLGDRRSPRGAQSDPLNQR 60 Query: 595 KLGT 606 KLGT Sbjct: 61 KLGT 64 >ref|XP_006348373.1| PREDICTED: interactor of constitutive active ROPs 1-like [Solanum tuberosum] Length = 375 Score = 80.1 bits (196), Expect = 4e-13 Identities = 41/64 (64%), Positives = 50/64 (78%), Gaps = 1/64 (1%) Frame = +1 Query: 418 MRRSRVTEISQRQSPRGPPSLRTSSSDSDHVHPRPRTERTPKLAEGRA-RGTQSDPSNQK 594 M RSR +E+ QRQSPR P LRTSSS+SD +H RP T+R+PKL + R+ RG QSDP NQ+ Sbjct: 1 MPRSRGSEMPQRQSPRAPSQLRTSSSESDPLHHRPVTDRSPKLGDRRSPRGAQSDPLNQR 60 Query: 595 KLGT 606 KLGT Sbjct: 61 KLGT 64 >gb|ESW21315.1| hypothetical protein PHAVU_005G060700g [Phaseolus vulgaris] Length = 380 Score = 79.3 bits (194), Expect = 7e-13 Identities = 41/64 (64%), Positives = 50/64 (78%), Gaps = 1/64 (1%) Frame = +1 Query: 418 MRRSRVTEISQRQSPRGPPSLRTSSSDSDHVHPRPRTERTPKLAEGRA-RGTQSDPSNQK 594 M RSR +++ QRQSPRGP LRTSSSDSD +H RP +R+PKL + R+ RGTQS+ NQK Sbjct: 1 MPRSRGSDLPQRQSPRGPHQLRTSSSDSDPLHHRPIADRSPKLGDRRSPRGTQSEALNQK 60 Query: 595 KLGT 606 KLGT Sbjct: 61 KLGT 64 >gb|EMJ15095.1| hypothetical protein PRUPE_ppa007058mg [Prunus persica] Length = 384 Score = 79.3 bits (194), Expect = 7e-13 Identities = 42/64 (65%), Positives = 50/64 (78%), Gaps = 1/64 (1%) Frame = +1 Query: 418 MRRSRVTEISQRQSPRGPPSLRTSSSDSDHVHPRPRTERTPKLAEGRA-RGTQSDPSNQK 594 M RSR +E+ QR SPRG LRTSSSDSD +H RP T+R+PKL + R+ RG+QSDP NQK Sbjct: 1 MPRSRGSEMVQRPSPRGAHQLRTSSSDSDPLHHRPITDRSPKLGDRRSPRGSQSDPLNQK 60 Query: 595 KLGT 606 KLGT Sbjct: 61 KLGT 64 >emb|CBI32925.3| unnamed protein product [Vitis vinifera] Length = 362 Score = 75.9 bits (185), Expect = 8e-12 Identities = 40/64 (62%), Positives = 49/64 (76%), Gaps = 1/64 (1%) Frame = +1 Query: 418 MRRSRVTEISQRQSPRGPPSLRTSSSDSDHVHPRPRTERTPKLAEGRA-RGTQSDPSNQK 594 M R+R +E+ QRQSPRG LRTSSSDSD +H RP T+R+PK+ + R+ RG QSD NQK Sbjct: 1 MPRTRGSEMPQRQSPRGSLQLRTSSSDSDPLHHRPITDRSPKVGDRRSPRGAQSDSVNQK 60 Query: 595 KLGT 606 KLGT Sbjct: 61 KLGT 64 >gb|EOY13689.1| Interactor of constitutive active rops 1 isoform 1 [Theobroma cacao] Length = 384 Score = 74.3 bits (181), Expect = 2e-11 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 3/66 (4%) Frame = +1 Query: 418 MRRSRVTEISQRQSPRGPPSLRTSSSDSDHVHPRPRTER-TPKLAEGRA-RGT-QSDPSN 588 M RSR +EI QRQSPRGP LR+SSSDSD +H RP T+R +P+L + R+ RG QSDP N Sbjct: 1 MPRSRSSEIPQRQSPRGPHQLRSSSSDSDPLHHRPITDRSSPRLGDRRSPRGAPQSDPLN 60 Query: 589 QKKLGT 606 QKKLGT Sbjct: 61 QKKLGT 66 >ref|XP_003543151.1| PREDICTED: interactor of constitutive active ROPs 4-like isoformX1 [Glycine max] gi|356549542|ref|XP_003543152.1| PREDICTED: interactor of constitutive active ROPs 4-like isoformX2 [Glycine max] gi|571500672|ref|XP_006594682.1| PREDICTED: interactor of constitutive active ROPs 4-like isoform X3 [Glycine max] gi|571500676|ref|XP_006594683.1| PREDICTED: interactor of constitutive active ROPs 4-like isoform X4 [Glycine max] gi|571500679|ref|XP_006594684.1| PREDICTED: interactor of constitutive active ROPs 4-like isoform X5 [Glycine max] gi|571500682|ref|XP_006594685.1| PREDICTED: interactor of constitutive active ROPs 4-like isoform X6 [Glycine max] gi|571500686|ref|XP_006594686.1| PREDICTED: interactor of constitutive active ROPs 4-like isoform X7 [Glycine max] Length = 377 Score = 74.3 bits (181), Expect = 2e-11 Identities = 40/64 (62%), Positives = 48/64 (75%), Gaps = 1/64 (1%) Frame = +1 Query: 418 MRRSRVTEISQRQSPRGPPSLRTSSSDSDHVHPRPRTERTPKLAEGRA-RGTQSDPSNQK 594 M RSR +E+ QRQSPRG RTSSSDSD +H RP +R+PKL + R+ RGTQS+ NQK Sbjct: 1 MPRSRGSELPQRQSPRGAHQHRTSSSDSDPLHHRPIADRSPKLGDRRSPRGTQSEGLNQK 60 Query: 595 KLGT 606 KLGT Sbjct: 61 KLGT 64 >ref|XP_003546766.1| PREDICTED: interactor of constitutive active ROPs 4 isoformX1 [Glycine max] gi|356556918|ref|XP_003546767.1| PREDICTED: interactor of constitutive active ROPs 4 isoformX2 [Glycine max] gi|571521467|ref|XP_006598164.1| PREDICTED: interactor of constitutive active ROPs 4 isoform X3 [Glycine max] gi|571521471|ref|XP_006598165.1| PREDICTED: interactor of constitutive active ROPs 4 isoform X4 [Glycine max] gi|571521476|ref|XP_006598166.1| PREDICTED: interactor of constitutive active ROPs 4 isoform X5 [Glycine max] Length = 380 Score = 73.6 bits (179), Expect = 4e-11 Identities = 40/64 (62%), Positives = 48/64 (75%), Gaps = 1/64 (1%) Frame = +1 Query: 418 MRRSRVTEISQRQSPRGPPSLRTSSSDSDHVHPRPRTERTPKLAEGRA-RGTQSDPSNQK 594 M RSR +E+ QRQSPRGP RTSSSDSD +H R +R+PKL + R+ RGTQS+ NQK Sbjct: 1 MPRSRGSELPQRQSPRGPHQHRTSSSDSDPLHHRLIADRSPKLGDRRSPRGTQSEGLNQK 60 Query: 595 KLGT 606 KLGT Sbjct: 61 KLGT 64 >ref|XP_004488646.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform X1 [Cicer arietinum] gi|502087801|ref|XP_004488647.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform X2 [Cicer arietinum] gi|502087804|ref|XP_004488648.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform X3 [Cicer arietinum] gi|502087807|ref|XP_004488649.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform X4 [Cicer arietinum] Length = 364 Score = 72.8 bits (177), Expect = 7e-11 Identities = 40/65 (61%), Positives = 50/65 (76%), Gaps = 2/65 (3%) Frame = +1 Query: 418 MRRSRVTEISQRQSPRGPPSLRTSSSDSDHVHPRPRTERTPKLAEGRA-RG-TQSDPSNQ 591 M RSR +++ QRQSPRG +RTSSSDSD +H RP T+R+PKL + R+ RG TQS+ NQ Sbjct: 1 MPRSRGSDLPQRQSPRGTHQIRTSSSDSDPLHHRPITDRSPKLGDRRSPRGTTQSETVNQ 60 Query: 592 KKLGT 606 KKLGT Sbjct: 61 KKLGT 65 >gb|EXB52700.1| hypothetical protein L484_022477 [Morus notabilis] Length = 389 Score = 72.4 bits (176), Expect = 9e-11 Identities = 37/58 (63%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = +1 Query: 436 TEISQRQSPRGPPSLRTSSSDSDHVHPRPRTERTPKLAEGRA-RGTQSDPSNQKKLGT 606 +E+SQR S R PP LRTSSSDSD +H RP T R+PK+ + R+ R QSDP NQKKLGT Sbjct: 22 SEVSQRPSTRVPPHLRTSSSDSDSLHHRPITNRSPKVGDRRSPRSVQSDPVNQKKLGT 79 >ref|XP_004294109.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform 1 [Fragaria vesca subsp. vesca] gi|470115862|ref|XP_004294110.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform 2 [Fragaria vesca subsp. vesca] Length = 379 Score = 72.4 bits (176), Expect = 9e-11 Identities = 38/64 (59%), Positives = 49/64 (76%), Gaps = 1/64 (1%) Frame = +1 Query: 418 MRRSRVTEISQRQSPRGPPSLRTSSSDSDHVHPRPRTERTPKLAEGRA-RGTQSDPSNQK 594 M RSR +E+ Q+ + RG LRTSSSDS+ +H RP T+R+PKL + R+ RG+QSDP NQK Sbjct: 1 MPRSRGSEVVQKPTLRGSHKLRTSSSDSEPLHHRPITDRSPKLGDRRSPRGSQSDPLNQK 60 Query: 595 KLGT 606 KLGT Sbjct: 61 KLGT 64 >gb|EOY13690.1| Interactor of constitutive active rops 1 isoform 2 [Theobroma cacao] Length = 386 Score = 71.2 bits (173), Expect = 2e-10 Identities = 41/64 (64%), Positives = 49/64 (76%), Gaps = 3/64 (4%) Frame = +1 Query: 424 RSRVTEISQRQSPRGPPSLRTSSSDSDHVHPRPRTER-TPKLAEGRA-RGT-QSDPSNQK 594 R R +EI QRQSPRGP LR+SSSDSD +H RP T+R +P+L + R+ RG QSDP NQK Sbjct: 5 RCRSSEIPQRQSPRGPHQLRSSSSDSDPLHHRPITDRSSPRLGDRRSPRGAPQSDPLNQK 64 Query: 595 KLGT 606 KLGT Sbjct: 65 KLGT 68 >ref|XP_006477921.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform X1 [Citrus sinensis] gi|568848230|ref|XP_006477922.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform X2 [Citrus sinensis] gi|568848232|ref|XP_006477923.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform X3 [Citrus sinensis] gi|568848234|ref|XP_006477924.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform X4 [Citrus sinensis] Length = 384 Score = 70.5 bits (171), Expect = 3e-10 Identities = 40/65 (61%), Positives = 46/65 (70%), Gaps = 2/65 (3%) Frame = +1 Query: 418 MRRSRVTEISQRQSPRGPPSLRTSSSDSDHVHPRPRTERTPKLAEGRA-RGT-QSDPSNQ 591 M RSR E+ QRQSPR P LRTSSSDSD H RP +R+PK+ + R+ RG SDP NQ Sbjct: 1 MPRSRGLEMPQRQSPRRPHQLRTSSSDSDPPHHRPIADRSPKIGDRRSPRGAPHSDPINQ 60 Query: 592 KKLGT 606 KKLGT Sbjct: 61 KKLGT 65 >ref|XP_006442245.1| hypothetical protein CICLE_v10020573mg [Citrus clementina] gi|567899516|ref|XP_006442246.1| hypothetical protein CICLE_v10020573mg [Citrus clementina] gi|567899518|ref|XP_006442247.1| hypothetical protein CICLE_v10020573mg [Citrus clementina] gi|567899520|ref|XP_006442248.1| hypothetical protein CICLE_v10020573mg [Citrus clementina] gi|557544507|gb|ESR55485.1| hypothetical protein CICLE_v10020573mg [Citrus clementina] gi|557544508|gb|ESR55486.1| hypothetical protein CICLE_v10020573mg [Citrus clementina] gi|557544509|gb|ESR55487.1| hypothetical protein CICLE_v10020573mg [Citrus clementina] gi|557544510|gb|ESR55488.1| hypothetical protein CICLE_v10020573mg [Citrus clementina] Length = 384 Score = 70.5 bits (171), Expect = 3e-10 Identities = 40/65 (61%), Positives = 46/65 (70%), Gaps = 2/65 (3%) Frame = +1 Query: 418 MRRSRVTEISQRQSPRGPPSLRTSSSDSDHVHPRPRTERTPKLAEGRA-RGT-QSDPSNQ 591 M RSR E+ QRQSPR P LRTSSSDSD H RP +R+PK+ + R+ RG SDP NQ Sbjct: 1 MPRSRGLEMPQRQSPRRPHQLRTSSSDSDPPHHRPIADRSPKIGDRRSPRGAPHSDPINQ 60 Query: 592 KKLGT 606 KKLGT Sbjct: 61 KKLGT 65 >ref|XP_002271827.2| PREDICTED: interactor of constitutive active ROPs 4-like [Vitis vinifera] Length = 346 Score = 69.3 bits (168), Expect = 8e-10 Identities = 36/54 (66%), Positives = 42/54 (77%), Gaps = 1/54 (1%) Frame = +1 Query: 448 QRQSPRGPPSLRTSSSDSDHVHPRPRTERTPKLAEGRA-RGTQSDPSNQKKLGT 606 QRQSPRG LRTSSSDSD +H RP T+R+PK+ + R+ RG QSD NQKKLGT Sbjct: 3 QRQSPRGSLQLRTSSSDSDPLHHRPITDRSPKVGDRRSPRGAQSDSVNQKKLGT 56 >emb|CAN73256.1| hypothetical protein VITISV_002134 [Vitis vinifera] Length = 376 Score = 69.3 bits (168), Expect = 8e-10 Identities = 36/54 (66%), Positives = 42/54 (77%), Gaps = 1/54 (1%) Frame = +1 Query: 448 QRQSPRGPPSLRTSSSDSDHVHPRPRTERTPKLAEGRA-RGTQSDPSNQKKLGT 606 QRQSPRG LRTSSSDSD +H RP T+R+PK+ + R+ RG QSD NQKKLGT Sbjct: 3 QRQSPRGSLQLRTSSSDSDPLHHRPITDRSPKVGDRRSPRGAQSDSVNQKKLGT 56 >ref|XP_004487468.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform X1 [Cicer arietinum] gi|502083470|ref|XP_004487469.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform X2 [Cicer arietinum] gi|502083473|ref|XP_004487470.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform X3 [Cicer arietinum] gi|502083476|ref|XP_004487471.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform X4 [Cicer arietinum] gi|502083479|ref|XP_004487472.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform X5 [Cicer arietinum] gi|502083482|ref|XP_004487473.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform X6 [Cicer arietinum] gi|502083485|ref|XP_004487474.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform X7 [Cicer arietinum] Length = 362 Score = 66.2 bits (160), Expect = 6e-09 Identities = 39/65 (60%), Positives = 47/65 (72%), Gaps = 2/65 (3%) Frame = +1 Query: 418 MRRSRVTEISQRQSPRGPPSLRTSSSDSDHVHPRPRTERTPKLAEGR-ARG-TQSDPSNQ 591 M RSR +++ QRQSPRG LRTSSSDSD +H R +R+PKL R +RG TQS+ NQ Sbjct: 1 MPRSRGSDLPQRQSPRGTHLLRTSSSDSDPLHHRLIADRSPKLGNRRSSRGTTQSETVNQ 60 Query: 592 KKLGT 606 KKLGT Sbjct: 61 KKLGT 65 >ref|XP_002300426.2| hypothetical protein POPTR_0001s38710g [Populus trichocarpa] gi|550349202|gb|EEE85231.2| hypothetical protein POPTR_0001s38710g [Populus trichocarpa] Length = 364 Score = 60.8 bits (146), Expect = 3e-07 Identities = 33/54 (61%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = +1 Query: 448 QRQSPRGPPSLRTSSSDSDHVHPRPRTERTPKLAEG-RARGTQSDPSNQKKLGT 606 QRQSPRG LRTS+SDSD +H RP T+R KL + RG+Q D NQKKLGT Sbjct: 3 QRQSPRGSHPLRTSNSDSDPLHHRPITDRREKLGDRCSPRGSQPDSLNQKKLGT 56 >ref|XP_002530129.1| conserved hypothetical protein [Ricinus communis] gi|223530354|gb|EEF32245.1| conserved hypothetical protein [Ricinus communis] Length = 383 Score = 59.7 bits (143), Expect = 6e-07 Identities = 35/64 (54%), Positives = 43/64 (67%), Gaps = 1/64 (1%) Frame = +1 Query: 418 MRRSRVTEISQRQSPRGPPSLRTSSSDSDHVHPRPRTERTPKLAEGRA-RGTQSDPSNQK 594 M RSR +E+ QR RG LRTSSSDSD +H R T+R+ KL + R+ RG+ D NQK Sbjct: 1 MPRSRGSEMPQRLVSRGSHPLRTSSSDSDPLHHRSITDRSLKLGDRRSPRGSHPDSLNQK 60 Query: 595 KLGT 606 KLGT Sbjct: 61 KLGT 64 >ref|XP_004251832.1| PREDICTED: interactor of constitutive active ROPs 1-like [Solanum lycopersicum] Length = 339 Score = 58.2 bits (139), Expect = 2e-06 Identities = 34/63 (53%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = +1 Query: 418 MRRSRVTEISQRQSPRGPPSLRTSSSDSDHVHPRPRTERTPKLAEGRA-RGTQSDPSNQK 594 M R R +++ QRQSPR P LRTSSSDSD +R+PK+ + R+ RG QSDP QK Sbjct: 1 MPRLRGSDMLQRQSPRVPSQLRTSSSDSD--------QRSPKIGDRRSPRGVQSDPVKQK 52 Query: 595 KLG 603 KLG Sbjct: 53 KLG 55