BLASTX nr result
ID: Rehmannia25_contig00024574
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00024574 (319 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521442.1| tRNA, putative [Ricinus communis] gi|2235393... 58 1e-06 ref|XP_006470287.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltra... 57 2e-06 ref|XP_006446544.1| hypothetical protein CICLE_v100160112mg [Cit... 57 2e-06 gb|EOY02455.1| S-adenosyl-L-methionine-dependent methyltransfera... 57 2e-06 >ref|XP_002521442.1| tRNA, putative [Ricinus communis] gi|223539341|gb|EEF40932.1| tRNA, putative [Ricinus communis] Length = 311 Score = 57.8 bits (138), Expect = 1e-06 Identities = 35/52 (67%), Positives = 37/52 (71%), Gaps = 2/52 (3%) Frame = -3 Query: 266 DFVFFYLVQPCLAIPSAAKMLKQDDRVLCSISIAI--IQRSCETPRLNFTGL 117 D VF L QP LAIPSAAKMLKQD VLCS S I +QRSCET R NFT + Sbjct: 183 DSVFLDLPQPWLAIPSAAKMLKQDG-VLCSFSPCIEQVQRSCETLRSNFTDI 233 >ref|XP_006470287.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A-like isoform X1 [Citrus sinensis] gi|568832114|ref|XP_006470288.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A-like isoform X2 [Citrus sinensis] gi|568832116|ref|XP_006470289.1| PREDICTED: tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A-like isoform X3 [Citrus sinensis] Length = 311 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/53 (62%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = -3 Query: 269 ADFVFFYLVQPCLAIPSAAKMLKQDDRVLCSISIAI--IQRSCETPRLNFTGL 117 AD +F L QP LAIPSA KMLKQD +LCS S I +QRSCE+ RLNFT + Sbjct: 182 ADSIFLDLPQPWLAIPSAKKMLKQDG-ILCSFSPCIEQVQRSCESLRLNFTDI 233 >ref|XP_006446544.1| hypothetical protein CICLE_v100160112mg [Citrus clementina] gi|567908463|ref|XP_006446545.1| hypothetical protein CICLE_v100160112mg, partial [Citrus clementina] gi|567908465|ref|XP_006446546.1| hypothetical protein CICLE_v100160112mg [Citrus clementina] gi|557549155|gb|ESR59784.1| hypothetical protein CICLE_v100160112mg [Citrus clementina] gi|557549156|gb|ESR59785.1| hypothetical protein CICLE_v100160112mg, partial [Citrus clementina] gi|557549157|gb|ESR59786.1| hypothetical protein CICLE_v100160112mg [Citrus clementina] Length = 311 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/53 (62%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = -3 Query: 269 ADFVFFYLVQPCLAIPSAAKMLKQDDRVLCSISIAI--IQRSCETPRLNFTGL 117 AD +F L QP LAIPSA KMLKQD +LCS S I +QRSCE+ RLNFT + Sbjct: 182 ADSIFLDLPQPWLAIPSAKKMLKQDG-ILCSFSPCIEQVQRSCESLRLNFTDI 233 >gb|EOY02455.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily protein [Theobroma cacao] Length = 310 Score = 57.4 bits (137), Expect = 2e-06 Identities = 34/53 (64%), Positives = 37/53 (69%), Gaps = 2/53 (3%) Frame = -3 Query: 269 ADFVFFYLVQPCLAIPSAAKMLKQDDRVLCSISIAI--IQRSCETPRLNFTGL 117 AD VF L QP LAIPSA KMLKQD +LCS S I +QRSCET R NFT + Sbjct: 182 ADSVFLDLPQPWLAIPSAGKMLKQDG-ILCSFSPCIEQVQRSCETLRSNFTDI 233