BLASTX nr result
ID: Rehmannia25_contig00024477
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00024477 (420 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006346087.1| PREDICTED: KH domain-containing protein At5g... 61 2e-07 ref|XP_006346086.1| PREDICTED: KH domain-containing protein At5g... 61 2e-07 ref|XP_004244007.1| PREDICTED: KH domain-containing protein At5g... 61 2e-07 ref|XP_004244006.1| PREDICTED: KH domain-containing protein At5g... 61 2e-07 ref|XP_002274648.1| PREDICTED: KH domain-containing protein At5g... 60 2e-07 gb|EXB51069.1| KH domain-containing protein [Morus notabilis] 59 5e-07 gb|ESW20642.1| hypothetical protein PHAVU_005G003500g [Phaseolus... 58 1e-06 ref|XP_002299073.2| KH domain-containing family protein [Populus... 58 1e-06 gb|ABK93571.1| unknown [Populus trichocarpa] 58 1e-06 ref|XP_006377999.1| hypothetical protein POPTR_0011s17110g [Popu... 58 1e-06 ref|XP_002330577.1| predicted protein [Populus trichocarpa] 58 1e-06 ref|XP_006474774.1| PREDICTED: KH domain-containing protein At5g... 57 2e-06 ref|XP_006857601.1| hypothetical protein AMTR_s00061p00100880 [A... 57 2e-06 ref|XP_006452752.1| hypothetical protein CICLE_v10009077mg [Citr... 57 3e-06 ref|XP_006452750.1| hypothetical protein CICLE_v10009077mg [Citr... 57 3e-06 ref|XP_006452747.1| hypothetical protein CICLE_v10009077mg [Citr... 57 3e-06 ref|XP_004139764.1| PREDICTED: KH domain-containing protein At5g... 57 3e-06 gb|AGV54732.1| KH domain-containing protein [Phaseolus vulgaris] 57 3e-06 ref|XP_003527575.1| PREDICTED: KH domain-containing protein At5g... 57 3e-06 ref|XP_004294880.1| PREDICTED: KH domain-containing protein At5g... 56 4e-06 >ref|XP_006346087.1| PREDICTED: KH domain-containing protein At5g56140-like isoform X2 [Solanum tuberosum] Length = 289 Score = 60.8 bits (146), Expect = 2e-07 Identities = 34/68 (50%), Positives = 39/68 (57%) Frame = +2 Query: 215 MSSGRYMAYXXXXXXXXXXXXXXXXXXXXXXXXXXVEQEKYLTELLAERNKINPFMAVLP 394 MSSGRYMAY EQEKYL+ELLAER+K+ PF+ VLP Sbjct: 1 MSSGRYMAYSPSPSAPQSPHIAGLRSASSAI----AEQEKYLSELLAERHKLGPFVPVLP 56 Query: 395 NCYRLLNQ 418 +CYRLLNQ Sbjct: 57 HCYRLLNQ 64 >ref|XP_006346086.1| PREDICTED: KH domain-containing protein At5g56140-like isoform X1 [Solanum tuberosum] Length = 293 Score = 60.8 bits (146), Expect = 2e-07 Identities = 34/68 (50%), Positives = 39/68 (57%) Frame = +2 Query: 215 MSSGRYMAYXXXXXXXXXXXXXXXXXXXXXXXXXXVEQEKYLTELLAERNKINPFMAVLP 394 MSSGRYMAY EQEKYL+ELLAER+K+ PF+ VLP Sbjct: 1 MSSGRYMAYSPSPSAPQSPHIAGLRSASSAI----AEQEKYLSELLAERHKLGPFVPVLP 56 Query: 395 NCYRLLNQ 418 +CYRLLNQ Sbjct: 57 HCYRLLNQ 64 >ref|XP_004244007.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 2 [Solanum lycopersicum] Length = 295 Score = 60.8 bits (146), Expect = 2e-07 Identities = 34/68 (50%), Positives = 39/68 (57%) Frame = +2 Query: 215 MSSGRYMAYXXXXXXXXXXXXXXXXXXXXXXXXXXVEQEKYLTELLAERNKINPFMAVLP 394 MSSGRYMAY EQEKYL+ELLAER+K+ PF+ VLP Sbjct: 1 MSSGRYMAYSPSPSAPQSPHIAGLRSASSAI----AEQEKYLSELLAERHKLGPFVPVLP 56 Query: 395 NCYRLLNQ 418 +CYRLLNQ Sbjct: 57 HCYRLLNQ 64 >ref|XP_004244006.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 1 [Solanum lycopersicum] Length = 299 Score = 60.8 bits (146), Expect = 2e-07 Identities = 34/68 (50%), Positives = 39/68 (57%) Frame = +2 Query: 215 MSSGRYMAYXXXXXXXXXXXXXXXXXXXXXXXXXXVEQEKYLTELLAERNKINPFMAVLP 394 MSSGRYMAY EQEKYL+ELLAER+K+ PF+ VLP Sbjct: 1 MSSGRYMAYSPSPSAPQSPHIAGLRSASSAI----AEQEKYLSELLAERHKLGPFVPVLP 56 Query: 395 NCYRLLNQ 418 +CYRLLNQ Sbjct: 57 HCYRLLNQ 64 >ref|XP_002274648.1| PREDICTED: KH domain-containing protein At5g56140 isoform 1 [Vitis vinifera] gi|296089986|emb|CBI39805.3| unnamed protein product [Vitis vinifera] Length = 287 Score = 60.5 bits (145), Expect = 2e-07 Identities = 35/68 (51%), Positives = 40/68 (58%) Frame = +2 Query: 215 MSSGRYMAYXXXXXXXXXXXXXXXXXXXXXXXXXXVEQEKYLTELLAERNKINPFMAVLP 394 MSSGRYMAY VEQEKYL+ELLAER+K++PFM VLP Sbjct: 1 MSSGRYMAYSPSPSTAPHSPHIAGLRSATSAL---VEQEKYLSELLAERHKLSPFMPVLP 57 Query: 395 NCYRLLNQ 418 + YRLLNQ Sbjct: 58 HSYRLLNQ 65 >gb|EXB51069.1| KH domain-containing protein [Morus notabilis] Length = 307 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +2 Query: 320 VEQEKYLTELLAERNKINPFMAVLPNCYRLLNQ 418 VEQEKYL+ELLAER+K++PFM VLPNCY+LL+Q Sbjct: 50 VEQEKYLSELLAERHKLSPFMPVLPNCYKLLSQ 82 >gb|ESW20642.1| hypothetical protein PHAVU_005G003500g [Phaseolus vulgaris] Length = 291 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +2 Query: 323 EQEKYLTELLAERNKINPFMAVLPNCYRLLNQ 418 EQ+KYL+ELL ERNK++PFMAVLP C+RLLNQ Sbjct: 35 EQDKYLSELLGERNKLSPFMAVLPQCFRLLNQ 66 >ref|XP_002299073.2| KH domain-containing family protein [Populus trichocarpa] gi|550350090|gb|EEE83878.2| KH domain-containing family protein [Populus trichocarpa] Length = 302 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 320 VEQEKYLTELLAERNKINPFMAVLPNCYRLLNQ 418 VEQEKYL+ELLAER+KI+PF+ VLPN YRLLNQ Sbjct: 45 VEQEKYLSELLAERHKISPFLPVLPNTYRLLNQ 77 >gb|ABK93571.1| unknown [Populus trichocarpa] Length = 89 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 320 VEQEKYLTELLAERNKINPFMAVLPNCYRLLNQ 418 VEQEKYL+ELLAER+KI+PF+ VLPN YRLLNQ Sbjct: 45 VEQEKYLSELLAERHKISPFLPVLPNTYRLLNQ 77 >ref|XP_006377999.1| hypothetical protein POPTR_0011s17110g [Populus trichocarpa] gi|550328605|gb|ERP55796.1| hypothetical protein POPTR_0011s17110g [Populus trichocarpa] Length = 301 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 320 VEQEKYLTELLAERNKINPFMAVLPNCYRLLNQ 418 VEQEKYL+ELLAER+KI PFM VLPN YRLLNQ Sbjct: 44 VEQEKYLSELLAERHKIIPFMPVLPNIYRLLNQ 76 >ref|XP_002330577.1| predicted protein [Populus trichocarpa] Length = 301 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 320 VEQEKYLTELLAERNKINPFMAVLPNCYRLLNQ 418 VEQEKYL+ELLAER+KI PFM VLPN YRLLNQ Sbjct: 44 VEQEKYLSELLAERHKIIPFMPVLPNIYRLLNQ 76 >ref|XP_006474774.1| PREDICTED: KH domain-containing protein At5g56140-like [Citrus sinensis] Length = 292 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +2 Query: 320 VEQEKYLTELLAERNKINPFMAVLPNCYRLLNQ 418 ++QEKYL+ELLAER+K+NPF+ VLPN YRLLNQ Sbjct: 35 LDQEKYLSELLAERHKLNPFLPVLPNAYRLLNQ 67 >ref|XP_006857601.1| hypothetical protein AMTR_s00061p00100880 [Amborella trichopoda] gi|548861697|gb|ERN19068.1| hypothetical protein AMTR_s00061p00100880 [Amborella trichopoda] Length = 286 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/68 (48%), Positives = 38/68 (55%) Frame = +2 Query: 215 MSSGRYMAYXXXXXXXXXXXXXXXXXXXXXXXXXXVEQEKYLTELLAERNKINPFMAVLP 394 MSSGRYMAY VEQ+KYL+ELLAER K+ PFM VLP Sbjct: 1 MSSGRYMAYSPSPSTAPHSPFRSAATAL-------VEQDKYLSELLAERQKLGPFMQVLP 53 Query: 395 NCYRLLNQ 418 + YR+LNQ Sbjct: 54 HSYRVLNQ 61 >ref|XP_006452752.1| hypothetical protein CICLE_v10009077mg [Citrus clementina] gi|557555978|gb|ESR65992.1| hypothetical protein CICLE_v10009077mg [Citrus clementina] Length = 279 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +2 Query: 320 VEQEKYLTELLAERNKINPFMAVLPNCYRLLNQ 418 ++QEKYL+ELLAER+K+NPF+ VLPN YRLLNQ Sbjct: 35 LDQEKYLSELLAERHKLNPFLPVLPNTYRLLNQ 67 >ref|XP_006452750.1| hypothetical protein CICLE_v10009077mg [Citrus clementina] gi|557555976|gb|ESR65990.1| hypothetical protein CICLE_v10009077mg [Citrus clementina] Length = 196 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +2 Query: 320 VEQEKYLTELLAERNKINPFMAVLPNCYRLLNQ 418 ++QEKYL+ELLAER+K+NPF+ VLPN YRLLNQ Sbjct: 35 LDQEKYLSELLAERHKLNPFLPVLPNTYRLLNQ 67 >ref|XP_006452747.1| hypothetical protein CICLE_v10009077mg [Citrus clementina] gi|557555973|gb|ESR65987.1| hypothetical protein CICLE_v10009077mg [Citrus clementina] Length = 292 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +2 Query: 320 VEQEKYLTELLAERNKINPFMAVLPNCYRLLNQ 418 ++QEKYL+ELLAER+K+NPF+ VLPN YRLLNQ Sbjct: 35 LDQEKYLSELLAERHKLNPFLPVLPNTYRLLNQ 67 >ref|XP_004139764.1| PREDICTED: KH domain-containing protein At5g56140-like [Cucumis sativus] gi|449508337|ref|XP_004163285.1| PREDICTED: KH domain-containing protein At5g56140-like [Cucumis sativus] Length = 296 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 320 VEQEKYLTELLAERNKINPFMAVLPNCYRLLNQ 418 +EQEKYL+ELLAER K++PFM VLPN YRLLNQ Sbjct: 39 LEQEKYLSELLAERQKLSPFMPVLPNSYRLLNQ 71 >gb|AGV54732.1| KH domain-containing protein [Phaseolus vulgaris] Length = 291 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 323 EQEKYLTELLAERNKINPFMAVLPNCYRLLNQ 418 EQ+KYL+ELL ERNK++PFMAVLP C+RL NQ Sbjct: 35 EQDKYLSELLGERNKLSPFMAVLPQCFRLFNQ 66 >ref|XP_003527575.1| PREDICTED: KH domain-containing protein At5g56140-like [Glycine max] Length = 292 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +2 Query: 323 EQEKYLTELLAERNKINPFMAVLPNCYRLLNQ 418 + +KYLTELL ERNK++PFMAVLP+C+RLLNQ Sbjct: 36 DPDKYLTELLGERNKLSPFMAVLPHCFRLLNQ 67 >ref|XP_004294880.1| PREDICTED: KH domain-containing protein At5g56140-like [Fragaria vesca subsp. vesca] Length = 297 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 323 EQEKYLTELLAERNKINPFMAVLPNCYRLLNQ 418 EQEKYL+ELL ER+K+ PF+ VLPNC+RLLNQ Sbjct: 40 EQEKYLSELLGERHKLGPFLPVLPNCFRLLNQ 71