BLASTX nr result
ID: Rehmannia25_contig00024320
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00024320 (368 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS68135.1| hypothetical protein M569_06635, partial [Genlise... 55 1e-05 >gb|EPS68135.1| hypothetical protein M569_06635, partial [Genlisea aurea] Length = 289 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -1 Query: 125 MENMSATKTQEEQWMVQNQVFRIYDLVCQLPPHAQSVNFEL 3 ME TKT+E+Q VQ VFRIY+LV LPPHAQS++FE+ Sbjct: 4 MEERELTKTEEDQLRVQTHVFRIYELVFNLPPHAQSLHFEI 44