BLASTX nr result
ID: Rehmannia25_contig00024014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00024014 (374 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGN95005.1| gibberellin receptor 1b [Prunus salicina] gi|5117... 74 3e-11 gb|EMJ01545.1| hypothetical protein PRUPE_ppa008128mg [Prunus pe... 74 3e-11 gb|ABB89021.1| CXE carboxylesterase [Actinidia deliciosa] 74 3e-11 gb|AFA35961.1| gid1-like gibberellin receptor [Nicotiana attenuata] 73 3e-11 ref|XP_004290704.1| PREDICTED: gibberellin receptor GID1B-like [... 72 6e-11 gb|AFD32892.1| GID1c [Malus domestica] 72 6e-11 ref|XP_002302813.1| hypothetical protein POPTR_0002s22840g [Popu... 72 6e-11 ref|XP_006362976.1| PREDICTED: gibberellin receptor GID1B-like [... 72 8e-11 gb|AHB17753.1| GA signaling receptor [Actinidia deliciosa] 72 8e-11 gb|AGN72649.1| gibberellin receptor GID1B [Petunia x hybrida] 72 8e-11 ref|XP_004240525.1| PREDICTED: gibberellin receptor GID1B-like i... 72 8e-11 ref|XP_003591590.1| Gibberellic acid receptor-b [Medicago trunca... 72 8e-11 ref|XP_002524767.1| Gibberellin receptor GID1, putative [Ricinus... 71 1e-10 ref|XP_006444187.1| hypothetical protein CICLE_v10020963mg [Citr... 71 2e-10 gb|AGU38487.1| GID1b [Camellia sinensis] 71 2e-10 gb|AFG17072.1| GID1A [Vitis vinifera] 71 2e-10 emb|CBI34320.3| unnamed protein product [Vitis vinifera] 71 2e-10 emb|CAN68335.1| hypothetical protein VITISV_040540 [Vitis vinifera] 71 2e-10 emb|CAN65915.1| hypothetical protein VITISV_000065 [Vitis vinifera] 71 2e-10 gb|AFD32891.1| GID1b [Malus domestica] 70 2e-10 >gb|AGN95005.1| gibberellin receptor 1b [Prunus salicina] gi|511782930|gb|AGN95007.1| gibberellin receptor 1b [Prunus salicina] Length = 344 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 265 MAGSNEVNVNESKRVVPLNTWILISNFKLAYNMLRR 372 MAGSNEVNVNESKRVVPLNTW+LISNFKLAYN+LRR Sbjct: 1 MAGSNEVNVNESKRVVPLNTWVLISNFKLAYNLLRR 36 >gb|EMJ01545.1| hypothetical protein PRUPE_ppa008128mg [Prunus persica] gi|462395747|gb|EMJ01546.1| hypothetical protein PRUPE_ppa008128mg [Prunus persica] Length = 344 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 265 MAGSNEVNVNESKRVVPLNTWILISNFKLAYNMLRR 372 MAGSNEVNVNESKRVVPLNTW+LISNFKLAYN+LRR Sbjct: 1 MAGSNEVNVNESKRVVPLNTWVLISNFKLAYNLLRR 36 >gb|ABB89021.1| CXE carboxylesterase [Actinidia deliciosa] Length = 346 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 265 MAGSNEVNVNESKRVVPLNTWILISNFKLAYNMLRR 372 MAGSNE+NVNESK+VVPLNTWILISNFKLAYNMLRR Sbjct: 1 MAGSNEINVNESKKVVPLNTWILISNFKLAYNMLRR 36 >gb|AFA35961.1| gid1-like gibberellin receptor [Nicotiana attenuata] Length = 345 Score = 73.2 bits (178), Expect = 3e-11 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 265 MAGSNEVNVNESKRVVPLNTWILISNFKLAYNMLRR 372 MAGSNE+N NESKRVVPLNTWILISNFKLAYNMLRR Sbjct: 1 MAGSNEINANESKRVVPLNTWILISNFKLAYNMLRR 36 >ref|XP_004290704.1| PREDICTED: gibberellin receptor GID1B-like [Fragaria vesca subsp. vesca] Length = 344 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 265 MAGSNEVNVNESKRVVPLNTWILISNFKLAYNMLRR 372 MAGSNEVN+NESKRVVPLNTW+LISNFKLAYN+LRR Sbjct: 1 MAGSNEVNLNESKRVVPLNTWVLISNFKLAYNLLRR 36 >gb|AFD32892.1| GID1c [Malus domestica] Length = 346 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 265 MAGSNEVNVNESKRVVPLNTWILISNFKLAYNMLRR 372 MAGSNEVNVNESK+VVPLNTW+LISNFKLAYN+LRR Sbjct: 1 MAGSNEVNVNESKKVVPLNTWVLISNFKLAYNLLRR 36 >ref|XP_002302813.1| hypothetical protein POPTR_0002s22840g [Populus trichocarpa] gi|222844539|gb|EEE82086.1| hypothetical protein POPTR_0002s22840g [Populus trichocarpa] Length = 344 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 265 MAGSNEVNVNESKRVVPLNTWILISNFKLAYNMLRR 372 MAGSNEVN+NESKRVVPLNTW+LISNFKLAYN+LRR Sbjct: 1 MAGSNEVNLNESKRVVPLNTWVLISNFKLAYNLLRR 36 >ref|XP_006362976.1| PREDICTED: gibberellin receptor GID1B-like [Solanum tuberosum] Length = 345 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 265 MAGSNEVNVNESKRVVPLNTWILISNFKLAYNMLRR 372 MAGSNE+N NESKRVVPLNTWILISNFKL+YNMLRR Sbjct: 1 MAGSNEINANESKRVVPLNTWILISNFKLSYNMLRR 36 >gb|AHB17753.1| GA signaling receptor [Actinidia deliciosa] Length = 346 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = +1 Query: 265 MAGSNEVNVNESKRVVPLNTWILISNFKLAYNMLRR 372 MAG+NE+N+NESK+VVPLNTWILISNFKLAYNMLRR Sbjct: 1 MAGNNEININESKKVVPLNTWILISNFKLAYNMLRR 36 >gb|AGN72649.1| gibberellin receptor GID1B [Petunia x hybrida] Length = 345 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 265 MAGSNEVNVNESKRVVPLNTWILISNFKLAYNMLRR 372 MAGSNE+N NESKRVVPLNTWILISNFKL+YNMLRR Sbjct: 1 MAGSNEINANESKRVVPLNTWILISNFKLSYNMLRR 36 >ref|XP_004240525.1| PREDICTED: gibberellin receptor GID1B-like isoform 1 [Solanum lycopersicum] Length = 345 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 265 MAGSNEVNVNESKRVVPLNTWILISNFKLAYNMLRR 372 MAGSNE+N NESKRVVPLNTWILISNFKL+YNMLRR Sbjct: 1 MAGSNEINANESKRVVPLNTWILISNFKLSYNMLRR 36 >ref|XP_003591590.1| Gibberellic acid receptor-b [Medicago truncatula] gi|355480638|gb|AES61841.1| Gibberellic acid receptor-b [Medicago truncatula] Length = 360 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = +1 Query: 232 RFGKKGFINNPMAGSNEVNVNESKRVVPLNTWILISNFKLAYNMLRR 372 R K I+ MAGSNEVN+NESK VVPLNTW+LISNFKLAYN+LRR Sbjct: 6 RAKKTNIIDINMAGSNEVNLNESKSVVPLNTWVLISNFKLAYNLLRR 52 >ref|XP_002524767.1| Gibberellin receptor GID1, putative [Ricinus communis] gi|223535951|gb|EEF37610.1| Gibberellin receptor GID1, putative [Ricinus communis] Length = 345 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = +1 Query: 265 MAGSNEVNVNESKRVVPLNTWILISNFKLAYNMLRR 372 MAG+NEVN+NESKRVVPLNTW+LISNFKLAYN+LRR Sbjct: 1 MAGTNEVNLNESKRVVPLNTWVLISNFKLAYNLLRR 36 >ref|XP_006444187.1| hypothetical protein CICLE_v10020963mg [Citrus clementina] gi|568852325|ref|XP_006479828.1| PREDICTED: gibberellin receptor GID1B-like [Citrus sinensis] gi|557546449|gb|ESR57427.1| hypothetical protein CICLE_v10020963mg [Citrus clementina] Length = 344 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 265 MAGSNEVNVNESKRVVPLNTWILISNFKLAYNMLRR 372 MAG NEVN+NESKRVVPLNTW+LISNFKLAYN+LRR Sbjct: 1 MAGGNEVNLNESKRVVPLNTWVLISNFKLAYNLLRR 36 >gb|AGU38487.1| GID1b [Camellia sinensis] Length = 345 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +1 Query: 265 MAGSNEVNVNESKRVVPLNTWILISNFKLAYNMLRR 372 MAGSNE+N NESKRVVPLNTWILISN KLAYNMLRR Sbjct: 1 MAGSNEINANESKRVVPLNTWILISNLKLAYNMLRR 36 >gb|AFG17072.1| GID1A [Vitis vinifera] Length = 344 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 265 MAGSNEVNVNESKRVVPLNTWILISNFKLAYNMLRR 372 MAGSNEVN++ESKRVVPLNTWILISNFKLAYN+LRR Sbjct: 1 MAGSNEVNLSESKRVVPLNTWILISNFKLAYNLLRR 36 >emb|CBI34320.3| unnamed protein product [Vitis vinifera] Length = 388 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 265 MAGSNEVNVNESKRVVPLNTWILISNFKLAYNMLRR 372 MAGSNEVN++ESKRVVPLNTWILISNFKLAYN+LRR Sbjct: 1 MAGSNEVNLSESKRVVPLNTWILISNFKLAYNLLRR 36 >emb|CAN68335.1| hypothetical protein VITISV_040540 [Vitis vinifera] Length = 435 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 265 MAGSNEVNVNESKRVVPLNTWILISNFKLAYNMLRR 372 MAGSNEVN++ESKRVVPLNTWILISNFKLAYN+LRR Sbjct: 368 MAGSNEVNLSESKRVVPLNTWILISNFKLAYNLLRR 403 >emb|CAN65915.1| hypothetical protein VITISV_000065 [Vitis vinifera] Length = 344 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 265 MAGSNEVNVNESKRVVPLNTWILISNFKLAYNMLRR 372 MAGSNEVN++ESKRVVPLNTWILISNFKLAYN+LRR Sbjct: 1 MAGSNEVNLSESKRVVPLNTWILISNFKLAYNLLRR 36 >gb|AFD32891.1| GID1b [Malus domestica] Length = 346 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = +1 Query: 265 MAGSNEVNVNESKRVVPLNTWILISNFKLAYNMLRR 372 MAGSNEV+VNESK+VVPLNTW+LISNFKLAYN+LRR Sbjct: 1 MAGSNEVSVNESKKVVPLNTWVLISNFKLAYNLLRR 36