BLASTX nr result
ID: Rehmannia25_contig00023928
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00023928 (364 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGW27199.1| 4-coumarate:coenzyme A ligase 9, partial [Salvia ... 55 1e-05 >gb|AGW27199.1| 4-coumarate:coenzyme A ligase 9, partial [Salvia miltiorrhiza] Length = 480 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +2 Query: 20 LKYVAKQVALYKKVRKVYFRAAIPRSASGKILRRS*R 130 + YVAKQVA YKKVRKVYF ++IPRS +GKILRR R Sbjct: 437 MSYVAKQVAPYKKVRKVYFSSSIPRSPAGKILRRELR 473