BLASTX nr result
ID: Rehmannia25_contig00023877
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00023877 (603 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20026.3| unnamed protein product [Vitis vinifera] 97 3e-18 ref|XP_002267905.1| PREDICTED: pentatricopeptide repeat-containi... 96 1e-17 ref|XP_002305261.1| pentatricopeptide repeat-containing family p... 96 1e-17 ref|XP_004297230.1| PREDICTED: proteinaceous RNase P 1, chloropl... 95 1e-17 ref|XP_002526061.1| multidrug resistance pump, putative [Ricinus... 94 2e-17 gb|EPS67119.1| hypothetical protein M569_07653 [Genlisea aurea] 94 3e-17 ref|XP_004241814.1| PREDICTED: proteinaceous RNase P 1, chloropl... 94 4e-17 ref|XP_002269315.1| PREDICTED: pentatricopeptide repeat-containi... 94 4e-17 emb|CBI21803.3| unnamed protein product [Vitis vinifera] 94 4e-17 gb|EXB44847.1| hypothetical protein L484_026428 [Morus notabilis] 93 5e-17 ref|XP_006353636.1| PREDICTED: proteinaceous RNase P 1, chloropl... 93 5e-17 ref|XP_006484639.1| PREDICTED: proteinaceous RNase P 1, chloropl... 93 6e-17 ref|XP_006437491.1| hypothetical protein CICLE_v10031025mg [Citr... 93 6e-17 ref|XP_006437490.1| hypothetical protein CICLE_v10031025mg [Citr... 93 6e-17 dbj|BAK07318.1| predicted protein [Hordeum vulgare subsp. vulgare] 92 8e-17 ref|XP_002323962.2| hypothetical protein POPTR_0017s01370g [Popu... 92 1e-16 ref|XP_002327484.1| predicted protein [Populus trichocarpa] 92 1e-16 gb|EMJ26904.1| hypothetical protein PRUPE_ppa003560mg [Prunus pe... 91 3e-16 gb|ACR37462.1| unknown [Zea mays] gi|414586240|tpg|DAA36811.1| T... 89 7e-16 ref|NP_001147555.1| antiporter/ drug transporter/ transporter [Z... 89 7e-16 >emb|CBI20026.3| unnamed protein product [Vitis vinifera] Length = 393 Score = 97.1 bits (240), Expect = 3e-18 Identities = 46/66 (69%), Positives = 51/66 (77%) Frame = -2 Query: 602 QVRLKPSSDGISLHMPPPYSIVIQESEVGSWHIPTVTGDDLETPRQWVCATRKRDGMTIP 423 QVRL + G LHMPPPYSIVIQESE GSWH+PTVTGDDLETPRQW+CATR R P Sbjct: 276 QVRLTITRRGPVLHMPPPYSIVIQESEQGSWHVPTVTGDDLETPRQWLCATRTRKNHRHP 335 Query: 422 *HSKLR 405 H +L+ Sbjct: 336 QHLELQ 341 >ref|XP_002267905.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32230, mitochondrial-like [Vitis vinifera] Length = 526 Score = 95.5 bits (236), Expect = 1e-17 Identities = 45/62 (72%), Positives = 48/62 (77%) Frame = -2 Query: 602 QVRLKPSSDGISLHMPPPYSIVIQESEVGSWHIPTVTGDDLETPRQWVCATRKRDGMTIP 423 QVRL + G LHMPPPYSIVIQESE GSWH+PTVTGDDLETPRQW+CATR R P Sbjct: 463 QVRLTITRRGPVLHMPPPYSIVIQESEQGSWHVPTVTGDDLETPRQWLCATRTRKNHRHP 522 Query: 422 *H 417 H Sbjct: 523 QH 524 >ref|XP_002305261.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222848225|gb|EEE85772.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 516 Score = 95.5 bits (236), Expect = 1e-17 Identities = 42/52 (80%), Positives = 45/52 (86%) Frame = -2 Query: 602 QVRLKPSSDGISLHMPPPYSIVIQESEVGSWHIPTVTGDDLETPRQWVCATR 447 QVRL S GI+LHMPPPYSIVIQESE G WH+PT TGDDLETPRQW+CATR Sbjct: 461 QVRLSVSRSGIALHMPPPYSIVIQESENGGWHVPTTTGDDLETPRQWLCATR 512 >ref|XP_004297230.1| PREDICTED: proteinaceous RNase P 1, chloroplastic/mitochondrial-like [Fragaria vesca subsp. vesca] Length = 564 Score = 95.1 bits (235), Expect = 1e-17 Identities = 41/55 (74%), Positives = 48/55 (87%) Frame = -2 Query: 602 QVRLKPSSDGISLHMPPPYSIVIQESEVGSWHIPTVTGDDLETPRQWVCATRKRD 438 QVR+ S G++LHMPPPYSIVIQESE GSWH+PT TGDD+ETPRQW+CATR R+ Sbjct: 508 QVRVSVSKLGLNLHMPPPYSIVIQESEDGSWHVPTTTGDDIETPRQWLCATRARN 562 >ref|XP_002526061.1| multidrug resistance pump, putative [Ricinus communis] gi|223534642|gb|EEF36338.1| multidrug resistance pump, putative [Ricinus communis] Length = 589 Score = 94.4 bits (233), Expect = 2e-17 Identities = 41/59 (69%), Positives = 50/59 (84%) Frame = -2 Query: 602 QVRLKPSSDGISLHMPPPYSIVIQESEVGSWHIPTVTGDDLETPRQWVCATRKRDGMTI 426 QVRL S GI+LHMPPPYSIVIQESE GSWH+PT++ DDLETPRQW+CA+R R+ + + Sbjct: 531 QVRLSVSRSGIALHMPPPYSIVIQESENGSWHVPTISEDDLETPRQWLCASRTRNKVVL 589 >gb|EPS67119.1| hypothetical protein M569_07653 [Genlisea aurea] Length = 553 Score = 94.0 bits (232), Expect = 3e-17 Identities = 39/54 (72%), Positives = 47/54 (87%) Frame = -2 Query: 602 QVRLKPSSDGISLHMPPPYSIVIQESEVGSWHIPTVTGDDLETPRQWVCATRKR 441 QVR+K +DGI L MPPPYS+VIQESE GSWH+PTV GDDLE PR+W+CATR++ Sbjct: 494 QVRIKVDNDGIRLKMPPPYSVVIQESEQGSWHVPTVRGDDLEAPREWICATRRK 547 >ref|XP_004241814.1| PREDICTED: proteinaceous RNase P 1, chloroplastic/mitochondrial-like [Solanum lycopersicum] Length = 567 Score = 93.6 bits (231), Expect = 4e-17 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 1/55 (1%) Frame = -2 Query: 602 QVRLKPS-SDGISLHMPPPYSIVIQESEVGSWHIPTVTGDDLETPRQWVCATRKR 441 Q+R+ S DG+ LHMPPPYSIVIQESE G WHIPT+TGDDLE PRQWVCATRK+ Sbjct: 506 QIRMTASRDDGLKLHMPPPYSIVIQESEQGCWHIPTLTGDDLEIPRQWVCATRKK 560 >ref|XP_002269315.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32230, mitochondrial-like [Vitis vinifera] Length = 895 Score = 93.6 bits (231), Expect = 4e-17 Identities = 44/62 (70%), Positives = 47/62 (75%) Frame = -2 Query: 602 QVRLKPSSDGISLHMPPPYSIVIQESEVGSWHIPTVTGDDLETPRQWVCATRKRDGMTIP 423 QVRL + G LHMPPPYSIVIQESE GSWH+PTV GDDLETPRQW+CATR R P Sbjct: 832 QVRLTMTRRGPVLHMPPPYSIVIQESEQGSWHVPTVIGDDLETPRQWLCATRTRKNHRHP 891 Query: 422 *H 417 H Sbjct: 892 QH 893 >emb|CBI21803.3| unnamed protein product [Vitis vinifera] Length = 339 Score = 93.6 bits (231), Expect = 4e-17 Identities = 44/62 (70%), Positives = 47/62 (75%) Frame = -2 Query: 602 QVRLKPSSDGISLHMPPPYSIVIQESEVGSWHIPTVTGDDLETPRQWVCATRKRDGMTIP 423 QVRL + G LHMPPPYSIVIQESE GSWH+PTV GDDLETPRQW+CATR R P Sbjct: 276 QVRLTMTRRGPVLHMPPPYSIVIQESEQGSWHVPTVIGDDLETPRQWLCATRTRKNHRHP 335 Query: 422 *H 417 H Sbjct: 336 QH 337 >gb|EXB44847.1| hypothetical protein L484_026428 [Morus notabilis] Length = 576 Score = 93.2 bits (230), Expect = 5e-17 Identities = 42/55 (76%), Positives = 46/55 (83%) Frame = -2 Query: 602 QVRLKPSSDGISLHMPPPYSIVIQESEVGSWHIPTVTGDDLETPRQWVCATRKRD 438 QVRL S+ G SLHMPPPYSIVIQESE G WH+P VTGDDLE PRQW+CATR R+ Sbjct: 520 QVRLSVSTKGPSLHMPPPYSIVIQESEDGRWHVPMVTGDDLEAPRQWLCATRDRN 574 >ref|XP_006353636.1| PREDICTED: proteinaceous RNase P 1, chloroplastic/mitochondrial-like isoform X1 [Solanum tuberosum] gi|565374171|ref|XP_006353637.1| PREDICTED: proteinaceous RNase P 1, chloroplastic/mitochondrial-like isoform X2 [Solanum tuberosum] Length = 574 Score = 93.2 bits (230), Expect = 5e-17 Identities = 41/55 (74%), Positives = 47/55 (85%), Gaps = 1/55 (1%) Frame = -2 Query: 602 QVRLKPS-SDGISLHMPPPYSIVIQESEVGSWHIPTVTGDDLETPRQWVCATRKR 441 Q+R+ S DG+ LHMPPPYSIVIQESE G WH+PT+TGDDLE PRQWVCATRK+ Sbjct: 506 QIRMTASRDDGLKLHMPPPYSIVIQESEQGCWHVPTLTGDDLEIPRQWVCATRKK 560 >ref|XP_006484639.1| PREDICTED: proteinaceous RNase P 1, chloroplastic/mitochondrial-like [Citrus sinensis] Length = 593 Score = 92.8 bits (229), Expect = 6e-17 Identities = 40/54 (74%), Positives = 46/54 (85%) Frame = -2 Query: 602 QVRLKPSSDGISLHMPPPYSIVIQESEVGSWHIPTVTGDDLETPRQWVCATRKR 441 Q+RL S DG++L MPPPYSIVIQESE GSWH+P +TGDDLE PRQW+CATR R Sbjct: 530 QIRLSVSRDGLNLLMPPPYSIVIQESENGSWHVPVITGDDLEAPRQWLCATRAR 583 >ref|XP_006437491.1| hypothetical protein CICLE_v10031025mg [Citrus clementina] gi|557539687|gb|ESR50731.1| hypothetical protein CICLE_v10031025mg [Citrus clementina] Length = 593 Score = 92.8 bits (229), Expect = 6e-17 Identities = 40/54 (74%), Positives = 46/54 (85%) Frame = -2 Query: 602 QVRLKPSSDGISLHMPPPYSIVIQESEVGSWHIPTVTGDDLETPRQWVCATRKR 441 Q+RL S DG++L MPPPYSIVIQESE GSWH+P +TGDDLE PRQW+CATR R Sbjct: 530 QIRLSVSRDGLNLLMPPPYSIVIQESENGSWHVPVITGDDLEAPRQWLCATRAR 583 >ref|XP_006437490.1| hypothetical protein CICLE_v10031025mg [Citrus clementina] gi|557539686|gb|ESR50730.1| hypothetical protein CICLE_v10031025mg [Citrus clementina] Length = 584 Score = 92.8 bits (229), Expect = 6e-17 Identities = 40/54 (74%), Positives = 46/54 (85%) Frame = -2 Query: 602 QVRLKPSSDGISLHMPPPYSIVIQESEVGSWHIPTVTGDDLETPRQWVCATRKR 441 Q+RL S DG++L MPPPYSIVIQESE GSWH+P +TGDDLE PRQW+CATR R Sbjct: 521 QIRLSVSRDGLNLLMPPPYSIVIQESENGSWHVPVITGDDLEAPRQWLCATRAR 574 >dbj|BAK07318.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 692 Score = 92.4 bits (228), Expect = 8e-17 Identities = 40/53 (75%), Positives = 45/53 (84%) Frame = -2 Query: 602 QVRLKPSSDGISLHMPPPYSIVIQESEVGSWHIPTVTGDDLETPRQWVCATRK 444 QVRL S G + H+PPPYSIVIQESE GSWH+PT TGDD+E+PRQWVCATRK Sbjct: 503 QVRLTYSGRGPTFHLPPPYSIVIQESEAGSWHVPTTTGDDIESPRQWVCATRK 555 >ref|XP_002323962.2| hypothetical protein POPTR_0017s01370g [Populus trichocarpa] gi|550319033|gb|EEF04095.2| hypothetical protein POPTR_0017s01370g [Populus trichocarpa] Length = 578 Score = 91.7 bits (226), Expect = 1e-16 Identities = 41/52 (78%), Positives = 44/52 (84%) Frame = -2 Query: 602 QVRLKPSSDGISLHMPPPYSIVIQESEVGSWHIPTVTGDDLETPRQWVCATR 447 QVRL S GI+L MPPPYSIVIQESE GSWH+PT T DDLETPRQW+CATR Sbjct: 523 QVRLSVSRSGIALQMPPPYSIVIQESENGSWHVPTTTNDDLETPRQWLCATR 574 >ref|XP_002327484.1| predicted protein [Populus trichocarpa] Length = 486 Score = 91.7 bits (226), Expect = 1e-16 Identities = 41/52 (78%), Positives = 44/52 (84%) Frame = -2 Query: 602 QVRLKPSSDGISLHMPPPYSIVIQESEVGSWHIPTVTGDDLETPRQWVCATR 447 QVRL S GI+L MPPPYSIVIQESE GSWH+PT T DDLETPRQW+CATR Sbjct: 431 QVRLSVSRSGIALQMPPPYSIVIQESENGSWHVPTTTNDDLETPRQWLCATR 482 >gb|EMJ26904.1| hypothetical protein PRUPE_ppa003560mg [Prunus persica] Length = 565 Score = 90.5 bits (223), Expect = 3e-16 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = -2 Query: 602 QVRLKPSSDGISLHMPPPYSIVIQESEVGSWHIPTVTGDDLETPRQWVCATR 447 QVR+ S G++LHMPPPYSIVIQESE G WH+PT GDD+ETPRQW+CATR Sbjct: 508 QVRMSVSRQGLALHMPPPYSIVIQESEDGRWHVPTTIGDDIETPRQWLCATR 559 >gb|ACR37462.1| unknown [Zea mays] gi|414586240|tpg|DAA36811.1| TPA: hypothetical protein ZEAMMB73_657460 [Zea mays] Length = 77 Score = 89.4 bits (220), Expect = 7e-16 Identities = 39/53 (73%), Positives = 44/53 (83%) Frame = -2 Query: 602 QVRLKPSSDGISLHMPPPYSIVIQESEVGSWHIPTVTGDDLETPRQWVCATRK 444 QVRL S G +LH+PPPYSIVIQESE GSWH+PT TGDD+E PRQW+C TRK Sbjct: 22 QVRLTFSGHGPTLHLPPPYSIVIQESEDGSWHVPTTTGDDIEKPRQWLCTTRK 74 >ref|NP_001147555.1| antiporter/ drug transporter/ transporter [Zea mays] gi|195612160|gb|ACG27910.1| antiporter/ drug transporter/ transporter [Zea mays] gi|219884449|gb|ACL52599.1| unknown [Zea mays] Length = 553 Score = 89.4 bits (220), Expect = 7e-16 Identities = 39/53 (73%), Positives = 44/53 (83%) Frame = -2 Query: 602 QVRLKPSSDGISLHMPPPYSIVIQESEVGSWHIPTVTGDDLETPRQWVCATRK 444 QVRL S G +LH+PPPYSIVIQESE GSWH+PT TGDD+E PRQW+C TRK Sbjct: 498 QVRLTFSGHGPTLHLPPPYSIVIQESEDGSWHVPTTTGDDIEKPRQWLCTTRK 550