BLASTX nr result
ID: Rehmannia25_contig00023674
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00023674 (330 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB50255.1| Aspartic proteinase nepenthesin-2 [Morus notabilis] 58 1e-06 gb|EXB50259.1| Aspartic proteinase nepenthesin-2 [Morus notabilis] 57 2e-06 ref|XP_006452219.1| hypothetical protein CICLE_v10010685mg [Citr... 57 2e-06 >gb|EXB50255.1| Aspartic proteinase nepenthesin-2 [Morus notabilis] Length = 496 Score = 58.2 bits (139), Expect = 1e-06 Identities = 36/72 (50%), Positives = 47/72 (65%), Gaps = 9/72 (12%) Frame = +3 Query: 102 CHCQTKIMFLH--VLLTVFQ------AAASKST-GFTLKLIPWDSPNSPLYQPNLTQTQK 254 C +T I+ LH +LLT+FQ + +SK T GF+LKLIP DSP SPLY NLTQ ++ Sbjct: 6 CLSKTHILVLHTTLLLTIFQTHNFHFSCSSKPTLGFSLKLIPRDSPESPLYPGNLTQIRR 65 Query: 255 IHIMAMSSKARA 290 + + SKARA Sbjct: 66 VERLINFSKARA 77 >gb|EXB50259.1| Aspartic proteinase nepenthesin-2 [Morus notabilis] Length = 463 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/64 (51%), Positives = 43/64 (67%), Gaps = 8/64 (12%) Frame = +3 Query: 123 MFLHV--LLTVFQ------AAASKSTGFTLKLIPWDSPNSPLYQPNLTQTQKIHIMAMSS 278 + LHV +LT+FQ + +SK +GF+LKLIP DSP SPLY NLTQTQ++ + S Sbjct: 10 LVLHVTLVLTIFQTHDFRFSYSSKPSGFSLKLIPRDSPESPLYPGNLTQTQRVERLIKFS 69 Query: 279 KARA 290 ARA Sbjct: 70 NARA 73 >ref|XP_006452219.1| hypothetical protein CICLE_v10010685mg [Citrus clementina] gi|557555445|gb|ESR65459.1| hypothetical protein CICLE_v10010685mg [Citrus clementina] Length = 438 Score = 57.4 bits (137), Expect = 2e-06 Identities = 36/81 (44%), Positives = 51/81 (62%), Gaps = 2/81 (2%) Frame = +3 Query: 84 MARLKLCHCQTKIMFLHVLLTVFQAAASKSTGFTLKLIPWDSPNSPLYQPNLTQTQKIHI 263 MA L+ I ++ VL+ + + +SK+TGF+LKLIP SP SPLY NLTQ ++IH Sbjct: 1 MAHLQAFSVAWHISYVTVLM-LLHSPSSKATGFSLKLIPLFSPESPLYPGNLTQFERIHK 59 Query: 264 MAMSSKARA--VSSTPKNETF 320 + SKARA ++S K + F Sbjct: 60 IFEISKARANYLTSMSKPDAF 80