BLASTX nr result
ID: Rehmannia25_contig00023337
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00023337 (305 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308346.2| hypothetical protein POPTR_0006s21110g [Popu... 57 2e-06 gb|EXB86907.1| Histone-lysine N-methyltransferase [Morus notabilis] 57 3e-06 >ref|XP_002308346.2| hypothetical protein POPTR_0006s21110g [Populus trichocarpa] gi|550336770|gb|EEE91869.2| hypothetical protein POPTR_0006s21110g [Populus trichocarpa] Length = 320 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 102 LVVLTEEWYTGVLPRIRINAFRIELAVGSYEDLL 1 + LT+EWY VL RIRINAFRIELAVGSYEDLL Sbjct: 196 MAFLTKEWYNSVLARIRINAFRIELAVGSYEDLL 229 >gb|EXB86907.1| Histone-lysine N-methyltransferase [Morus notabilis] Length = 401 Score = 56.6 bits (135), Expect = 3e-06 Identities = 34/58 (58%), Positives = 39/58 (67%), Gaps = 3/58 (5%) Frame = -3 Query: 168 WHALLSLFHEKNSSVVK-DCVFDLV--VLTEEWYTGVLPRIRINAFRIELAVGSYEDL 4 ++ L S F E N + K C F L VLT++WYTGVL RIRINAFRIELA YEDL Sbjct: 182 FNLLKSAFKEANVADEKMACCFSLTFKVLTKQWYTGVLARIRINAFRIELAGEPYEDL 239