BLASTX nr result
ID: Rehmannia25_contig00023298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00023298 (816 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006418989.1| hypothetical protein EUTSA_v10002384mg [Eutr... 62 3e-07 ref|XP_002877438.1| hypothetical protein ARALYDRAFT_484964 [Arab... 62 3e-07 ref|NP_190171.1| P-loop containing nucleoside triphosphate hydro... 62 3e-07 gb|EPS68865.1| hypothetical protein M569_05900, partial [Genlise... 59 2e-06 ref|XP_006409892.1| hypothetical protein EUTSA_v10016147mg [Eutr... 58 4e-06 ref|XP_006350736.1| PREDICTED: 125 kDa kinesin-related protein-l... 58 5e-06 ref|XP_004241257.1| PREDICTED: 125 kDa kinesin-related protein-l... 58 5e-06 >ref|XP_006418989.1| hypothetical protein EUTSA_v10002384mg [Eutrema salsugineum] gi|557096917|gb|ESQ37425.1| hypothetical protein EUTSA_v10002384mg [Eutrema salsugineum] Length = 1062 Score = 61.6 bits (148), Expect = 3e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 814 FLFDKVFGPSSQQKDLYDQAVCPIVFEVLE 725 F FDKVFGP+SQQKDLYDQA+CPIVFEVLE Sbjct: 102 FAFDKVFGPASQQKDLYDQAICPIVFEVLE 131 >ref|XP_002877438.1| hypothetical protein ARALYDRAFT_484964 [Arabidopsis lyrata subsp. lyrata] gi|297323276|gb|EFH53697.1| hypothetical protein ARALYDRAFT_484964 [Arabidopsis lyrata subsp. lyrata] Length = 1056 Score = 61.6 bits (148), Expect = 3e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 814 FLFDKVFGPSSQQKDLYDQAVCPIVFEVLE 725 F FDKVFGP+SQQKDLYDQA+CPIVFEVLE Sbjct: 95 FAFDKVFGPASQQKDLYDQAICPIVFEVLE 124 >ref|NP_190171.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein [Arabidopsis thaliana] gi|334185753|ref|NP_001190017.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein [Arabidopsis thaliana] gi|7339486|emb|CAB82809.1| kinesin-related protein-like [Arabidopsis thaliana] gi|332644559|gb|AEE78080.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein [Arabidopsis thaliana] gi|332644560|gb|AEE78081.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein [Arabidopsis thaliana] Length = 1058 Score = 61.6 bits (148), Expect = 3e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 814 FLFDKVFGPSSQQKDLYDQAVCPIVFEVLE 725 F FDKVFGP+SQQKDLYDQA+CPIVFEVLE Sbjct: 95 FAFDKVFGPASQQKDLYDQAICPIVFEVLE 124 >gb|EPS68865.1| hypothetical protein M569_05900, partial [Genlisea aurea] Length = 1044 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 814 FLFDKVFGPSSQQKDLYDQAVCPIVFEVLE 725 FLFDKVFGP+S+QKDLYDQAV PIVFEVLE Sbjct: 91 FLFDKVFGPASEQKDLYDQAVSPIVFEVLE 120 >ref|XP_006409892.1| hypothetical protein EUTSA_v10016147mg [Eutrema salsugineum] gi|557111061|gb|ESQ51345.1| hypothetical protein EUTSA_v10016147mg [Eutrema salsugineum] Length = 1353 Score = 58.2 bits (139), Expect = 4e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 814 FLFDKVFGPSSQQKDLYDQAVCPIVFEVLEE 722 FLFDKVFGP+SQQKDLY QAV PIVFEVL+E Sbjct: 403 FLFDKVFGPTSQQKDLYHQAVSPIVFEVLDE 433 >ref|XP_006350736.1| PREDICTED: 125 kDa kinesin-related protein-like [Solanum tuberosum] Length = 1044 Score = 57.8 bits (138), Expect = 5e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 814 FLFDKVFGPSSQQKDLYDQAVCPIVFEVLE 725 F+FDKV+GP+S+QKDLYD A+CPIVFEVLE Sbjct: 93 FVFDKVYGPTSKQKDLYDSAICPIVFEVLE 122 >ref|XP_004241257.1| PREDICTED: 125 kDa kinesin-related protein-like [Solanum lycopersicum] Length = 1038 Score = 57.8 bits (138), Expect = 5e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 814 FLFDKVFGPSSQQKDLYDQAVCPIVFEVLE 725 F+FDKV+GP+S+QKDLYD A+CPIVFEVLE Sbjct: 93 FVFDKVYGPTSKQKDLYDSAICPIVFEVLE 122