BLASTX nr result
ID: Rehmannia25_contig00022886
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00022886 (332 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB38221.1| hypothetical protein L484_006320 [Morus notabilis] 56 6e-06 >gb|EXB38221.1| hypothetical protein L484_006320 [Morus notabilis] Length = 249 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/59 (45%), Positives = 40/59 (67%) Frame = -1 Query: 182 MATSDQTREICFYKEWMNLQEQELSELRRAIDLNARGCTSDAELGQLINKIMNHFQNYV 6 MA+ DQ R C + EWM LQE++LSEL +A+ L + +DAEL +L K + HF++Y+ Sbjct: 1 MASGDQDRSKCCFLEWMKLQERDLSELLQALTLTPQ---NDAELTKLAQKAIEHFESYI 56