BLASTX nr result
ID: Rehmannia25_contig00022580
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00022580 (417 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEQ63711.1| NBS-LRR class resistance protein [Sesamum indicum] 62 1e-07 >gb|AEQ63711.1| NBS-LRR class resistance protein [Sesamum indicum] Length = 157 Score = 61.6 bits (148), Expect = 1e-07 Identities = 34/89 (38%), Positives = 52/89 (58%), Gaps = 1/89 (1%) Frame = +2 Query: 2 ELNMTNVLLDIMEELTS-NEDMSSLSYEDLLEIVYAYLKGGMFVLVFDDVRIVEAWNAIG 178 E ++ L I++E T +E+++ S +L ++V A+L G F++V DDV VE WN + Sbjct: 33 EFTKKDIFLAILKEFTRIDENVNGKSDHELAQLVAAHLDRGKFLIVMDDVWTVEDWNTLQ 92 Query: 179 SVLRKGNWMGKVFITSHALEVARHAHPNR 265 L N GKV ITS +EVA H + +R Sbjct: 93 IALPNNNKKGKVLITSRHVEVAHHVNRHR 121