BLASTX nr result
ID: Rehmannia25_contig00022576
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00022576 (375 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS62656.1| hypothetical protein M569_12132 [Genlisea aurea] 63 5e-08 ref|XP_002266688.1| PREDICTED: homeobox-leucine zipper protein P... 62 1e-07 ref|XP_004253429.1| PREDICTED: homeobox-leucine zipper protein M... 61 1e-07 ref|XP_006343296.1| PREDICTED: homeobox-leucine zipper protein M... 60 4e-07 >gb|EPS62656.1| hypothetical protein M569_12132 [Genlisea aurea] Length = 712 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -1 Query: 93 MFQPNMFDSHHHLLDMCHKTPENEMDLIRDE 1 MFQPNMFDSHHHLL+M HKTPEN++D+IRD+ Sbjct: 1 MFQPNMFDSHHHLLEMGHKTPENDLDIIRDD 31 >ref|XP_002266688.1| PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2 [Vitis vinifera] gi|302144076|emb|CBI23181.3| unnamed protein product [Vitis vinifera] Length = 726 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 93 MFQPNMFDSHHHLLDMCHKTPENEMDLIRDE 1 MFQPNMFDSHHHLLDM HKTPE+EM IRDE Sbjct: 1 MFQPNMFDSHHHLLDMPHKTPESEMGKIRDE 31 >ref|XP_004253429.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like, partial [Solanum lycopersicum] Length = 118 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -1 Query: 93 MFQPNMFDSHHHLLDMCHKTPENEMDLIRD 4 MFQPNMF+SHHHLLDM HK+PEN++DL+RD Sbjct: 1 MFQPNMFESHHHLLDMSHKSPENDLDLLRD 30 >ref|XP_006343296.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Solanum tuberosum] Length = 727 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -1 Query: 93 MFQPNMFDSHHHLLDMCHKTPENEMDLIRD 4 MFQPN+F+SHHHLLDM HK+PEN++DL+RD Sbjct: 1 MFQPNIFESHHHLLDMSHKSPENDLDLLRD 30