BLASTX nr result
ID: Rehmannia25_contig00022568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00022568 (416 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285551.1| PREDICTED: uncharacterized protein LOC100246... 55 7e-06 >ref|XP_002285551.1| PREDICTED: uncharacterized protein LOC100246883 [Vitis vinifera] gi|302142862|emb|CBI20157.3| unnamed protein product [Vitis vinifera] Length = 522 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/40 (62%), Positives = 28/40 (70%) Frame = +2 Query: 296 TGVDDEQKKDLAAGSHKRSKYFYYDTPLSEDTGAWIPVSV 415 TGVD++ D G K KYFYYD PLSE+TG WIPVSV Sbjct: 63 TGVDNDVLNDSFVGHKKPGKYFYYDLPLSEETGPWIPVSV 102