BLASTX nr result
ID: Rehmannia25_contig00022247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00022247 (485 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS63418.1| hypothetical protein M569_11366 [Genlisea aurea] 66 4e-09 >gb|EPS63418.1| hypothetical protein M569_11366 [Genlisea aurea] Length = 367 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/54 (55%), Positives = 38/54 (70%), Gaps = 2/54 (3%) Frame = +3 Query: 321 MDFRRENGFSNGNVVQILSGNPG--NGMDESWGVGSTDDVVWATEDDYGMWNNE 476 MD+R++NGFS GNVVQI+ GN N E+WG T+ VWATE+DY MW+ E Sbjct: 1 MDYRQDNGFSVGNVVQIIGGNGNSTNVSQENWGPMPTNQAVWATEEDYSMWSGE 54