BLASTX nr result

ID: Rehmannia25_contig00022052 seq

BLASTX 2.2.25 [Feb-01-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Rehmannia25_contig00022052
         (457 letters)

Database: ./nr 
           37,332,560 sequences; 13,225,080,153 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb|ADD63027.1| photosystem II protein M [Potamophila parviflora]       71   2e-10
ref|YP_008757427.1| photosystem II reaction center protein M (ch...    70   3e-10
ref|XP_003605618.1| Photosystem II reaction center protein M [Me...    69   5e-10
gb|ADD63094.1| photosystem II protein M [Microlaena stipoides]         68   1e-09
ref|NP_051053.1| photosystem II protein M [Arabidopsis thaliana]...    67   3e-09
gb|ADD30418.1| photosystem II protein M [Aucuba japonica] gi|290...    66   4e-09
ref|YP_740644.1| photosystem II protein M [Nandina domestica] gi...    66   4e-09
ref|YP_008578533.1| photosystem II protein M (chloroplast) [Ascl...    66   6e-09
ref|YP_008994562.1| photosystem II protein M (chloroplast) [Pela...    65   7e-09
ref|YP_008080492.1| photosystem II protein M (chloroplast) [Phar...    65   7e-09
ref|XP_002888353.1| hypothetical protein ARALYDRAFT_893970 [Arab...    62   8e-09
ref|NP_043013.1| photosystem II protein M [Zea mays] gi|48478761...    65   9e-09
gb|AGW04281.1| photosystem II protein M [Secamone afzelii]             65   9e-09
ref|YP_006666287.1| photosystem II protein M (chloroplast) [Pach...    65   9e-09
ref|YP_005296094.1| psbM gene product (chloroplast) [Pentactina ...    65   9e-09
ref|YP_003587462.1| photosystem II protein M [Oncidium hybrid cu...    65   9e-09
ref|YP_001542441.1| photosystem II protein M [Ceratophyllum deme...    65   9e-09
ref|YP_784467.1| photosystem II protein M [Piper cenocladum] gi|...    65   9e-09
gb|AAZ66146.1| PsbM [Symplocos bogotensis] gi|72011464|gb|AAZ661...    65   1e-08
ref|YP_398315.1| photosystem II reaction center M protein [Lactu...    65   1e-08

>gb|ADD63027.1| photosystem II protein M [Potamophila parviflora]
          Length = 69

 Score = 70.9 bits (172), Expect = 2e-10
 Identities = 41/61 (67%), Positives = 43/61 (70%)
 Frame = +2

Query: 113 IEFTDERFIISRGLNPELLRSKKTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQN 292
           +EFT   F       P     K   E+MEVNILAFIATALFILVPTAFLLIIYVKTVSQN
Sbjct: 12  LEFTGYPFYSPWDYIPSYCEKK---EVMEVNILAFIATALFILVPTAFLLIIYVKTVSQN 68

Query: 293 D 295
           D
Sbjct: 69  D 69


>ref|YP_008757427.1| photosystem II reaction center protein M (chloroplast) [Oryza
           rufipogon] gi|42795544|gb|AAS46110.1| photosystem II M
           protein [Oryza sativa Japonica Group]
           gi|42795608|gb|AAS46173.1| photosystem II M protein
           [Oryza sativa Japonica Group]
           gi|290790563|gb|ADD62823.1| photosystem II protein M
           [Oryza sativa Japonica Group]
           gi|290790632|gb|ADD62891.1| photosystem II protein M
           [Oryza meridionalis] gi|290790701|gb|ADD62959.1|
           photosystem II protein M [Oryza australiensis]
           gi|552954465|gb|AGY48933.1| photosystem II reaction
           center protein M (chloroplast) [Oryza rufipogon]
          Length = 69

 Score = 70.1 bits (170), Expect = 3e-10
 Identities = 41/61 (67%), Positives = 43/61 (70%)
 Frame = +2

Query: 113 IEFTDERFIISRGLNPELLRSKKTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQN 292
           +EFT   F       P     K   E+MEVNILAFIATALFILVPTAFLLIIYVKTVSQN
Sbjct: 12  LEFTGYPFPSPWDYIPSYCEKK---EVMEVNILAFIATALFILVPTAFLLIIYVKTVSQN 68

Query: 293 D 295
           D
Sbjct: 69  D 69


>ref|XP_003605618.1| Photosystem II reaction center protein M [Medicago truncatula]
           gi|355506673|gb|AES87815.1| Photosystem II reaction
           center protein M [Medicago truncatula]
          Length = 164

 Score = 69.3 bits (168), Expect = 5e-10
 Identities = 36/40 (90%), Positives = 38/40 (95%)
 Frame = +2

Query: 176 KKTDEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 295
           K+  EIMEVNILAFIATALFILVPTAFLLIIYVKTVSQ+D
Sbjct: 125 KENIEIMEVNILAFIATALFILVPTAFLLIIYVKTVSQSD 164


>gb|ADD63094.1| photosystem II protein M [Microlaena stipoides]
          Length = 69

 Score = 68.2 bits (165), Expect = 1e-09
 Identities = 34/36 (94%), Positives = 35/36 (97%)
 Frame = +2

Query: 188 EIMEVNILAFIATALFILVPTAFLLIIYVKTVSQND 295
           E+MEVNILAFIATALFILVPTAFLLIIYVKT SQND
Sbjct: 34  EVMEVNILAFIATALFILVPTAFLLIIYVKTASQND 69


>ref|NP_051053.1| photosystem II protein M [Arabidopsis thaliana]
           gi|11465948|ref|NP_054490.1| photosystem II protein M
           [Nicotiana tabacum] gi|11466775|ref|NP_039371.1|
           photosystem II protein M [Oryza sativa Japonica Group]
           gi|11497518|ref|NP_054926.1| photosystem II protein M
           [Spinacia oleracea] gi|28261711|ref|NP_783226.1|
           photosystem II protein M [Atropa belladonna]
           gi|50233959|ref|YP_052737.1| photosystem II protein M
           [Oryza nivara] gi|50346776|ref|YP_053149.1| photosystem
           II protein M [Nymphaea alba]
           gi|75755653|ref|YP_319759.1| photosystem II protein M
           [Acorus calamus] gi|78102526|ref|YP_358667.1|
           photosystem II protein M [Nicotiana sylvestris]
           gi|78103247|ref|YP_358572.1| photosystem II protein M
           [Phalaenopsis aphrodite subsp. formosana]
           gi|81301557|ref|YP_398854.1| photosystem II protein M
           [Nicotiana tomentosiformis] gi|91208982|ref|YP_538842.1|
           photosystem II protein M [Solanum bulbocastanum]
           gi|94502477|ref|YP_588103.1| photosystem II protein M
           [Helianthus annuus] gi|108773124|ref|YP_635633.1|
           photosystem II protein M [Solanum tuberosum]
           gi|114107040|ref|YP_740196.1| photosystem II protein M
           [Liriodendron tulipifera] gi|114329740|ref|YP_740559.1|
           photosystem II protein M [Platanus occidentalis]
           gi|115391896|ref|YP_778484.1| photosystem II protein M
           [Jasminum nudiflorum] gi|115604928|ref|YP_784380.1|
           photosystem II protein M [Drimys granadensis]
           gi|121720607|ref|YP_001001528.1| photosystem II protein
           M [Nuphar advena] gi|122893984|ref|YP_001004180.1|
           photosystem II protein M [Ranunculus macranthus]
           gi|139387246|ref|YP_001123367.1| photosystem II protein
           M [Capsella bursa-pastoris]
           gi|139388088|ref|YP_001123280.1| PSII low MW protein
           [Barbarea verna] gi|139388904|ref|YP_001123631.1|
           photosystem II protein M [Lepidium virginicum]
           gi|139389090|ref|YP_001123808.1| photosystem II protein
           M [Nasturtium officinale]
           gi|139389412|ref|YP_001123109.1| photosystem II protein
           M [Olimarabidopsis pumila]
           gi|139389795|ref|YP_001123456.1| photosystem II protein
           M [Crucihimalaya wallichii]
           gi|149390262|ref|YP_001294092.1| photosystem II protein
           M [Chloranthus spicatus]
           gi|149390348|ref|YP_001294346.1| photosystem II protein
           M [Dioscorea elephantipes]
           gi|149390436|ref|YP_001294264.1| photosystem II protein
           M [Illicium oligandrum] gi|149390534|ref|YP_001294178.1|
           photosystem II protein M [Buxus microphylla]
           gi|157325524|ref|YP_001468302.1| photosystem II protein
           M [Ipomoea purpurea] gi|161622304|ref|YP_001586176.1|
           photosystem II protein M [Acorus americanus]
           gi|161784186|ref|YP_001595502.1| PSII M protein [Lemna
           minor] gi|183217727|ref|YP_001837346.1| photosystem II
           protein M [Guizotia abyssinica]
           gi|189162265|ref|YP_001936511.1| photosystem II protein
           M [Fagopyrum esculentum subsp. ancestrale]
           gi|229577748|ref|YP_002836084.1| photosystem II protein
           M [Megaleranthis saniculifolia]
           gi|253729545|ref|YP_003029728.1| PsbM [Bambusa oldhamii]
           gi|255961371|ref|YP_003097564.1| photosystem II protein
           M [Dendrocalamus latiflorus]
           gi|283794962|ref|YP_003359353.1| photosystem II protein
           M (chloroplast) [Olea europaea]
           gi|289065083|ref|YP_003433969.1| photosystem II protein
           M [Typha latifolia] gi|292559503|ref|YP_003540925.1|
           photosystem II protein M [Phoenix dactylifera]
           gi|295065716|ref|YP_003587656.1| photosystem II protein
           M [Anomochloa marantoidea]
           gi|313183987|ref|YP_004021144.1| photosystem II protein
           M [Castanea mollissima] gi|330850737|ref|YP_004376415.1|
           photosystem II protein M [Olea europaea subsp. europaea]
           gi|334361943|ref|YP_004563861.1| photosystem II protein
           M [Nelumbo lutea] gi|334362043|ref|YP_004564097.1|
           photosystem II protein M [Nelumbo nucifera]
           gi|334700276|ref|YP_004563775.1| photosystem II protein
           M [Olea europaea subsp. cuspidata]
           gi|334701613|ref|YP_004563998.1| photosystem II protein
           M [Olea woodiana subsp. woodiana]
           gi|334701788|ref|YP_004564358.1| photosystem II protein
           M (chloroplast) [Ageratina adenophora]
           gi|334701882|ref|YP_004564491.1| photosystem II protein
           M [Olea europaea subsp. maroccana]
           gi|339906441|ref|YP_004733233.1| photosystem II protein
           M [Indocalamus longiauritus]
           gi|340034015|ref|YP_004733567.1| photosystem II protein
           M [Phyllostachys edulis]
           gi|340034186|ref|YP_004733749.1| photosystem II protein
           M [Acidosasa purpurea] gi|340034354|ref|YP_004733967.1|
           photosystem II protein M [Phyllostachys nigra var.
           henonis] gi|340034439|ref|YP_004734090.1| photosystem II
           protein M [Bambusa emeiensis]
           gi|340034525|ref|YP_004734174.1| photosystem II protein
           M [Ferrocalamus rimosivaginus]
           gi|342316115|ref|YP_004769624.1| photosystem II protein
           M (chloroplast) [Spirodela polyrhiza]
           gi|342316199|ref|YP_004769708.1| photosystem II protein
           M [Magnolia kwangsiensis]
           gi|342316284|ref|YP_004769806.1| photosystem II protein
           M (chloroplast) [Wolffiella lingulata]
           gi|342316368|ref|YP_004769941.1| photosystem II protein
           M (chloroplast) [Wolffia australiana]
           gi|351653870|ref|YP_004891595.1| psbM gene product
           (chloroplast) [Nicotiana undulata]
           gi|359422255|ref|YP_004935660.1| psbM gene product
           (chloroplast) [Sesamum indicum]
           gi|364283978|ref|YP_004940504.1| psbM gene product
           (chloroplast) [Boea hygrometrica]
           gi|374249255|ref|YP_005087998.1| psbM gene product
           [Leersia tisserantii] gi|374249339|ref|YP_005088521.1|
           psbM gene product (chloroplast) [Phyllostachys
           propinqua] gi|374249608|ref|YP_005089135.1| psbM gene
           product [Rhynchoryza subulata]
           gi|374249698|ref|YP_005089328.1| psbM gene product
           (chloroplast) [Silene vulgaris]
           gi|374249780|ref|YP_005089409.1| psbM gene product
           (chloroplast) [Silene noctiflora]
           gi|374249862|ref|YP_005089490.1| psbM gene product
           (chloroplast) [Silene conica]
           gi|374249944|ref|YP_005089571.1| psbM gene product
           (chloroplast) [Silene latifolia]
           gi|377819372|ref|YP_005097868.1| photosystem II protein
           M (chloroplast) [Colocasia esculenta]
           gi|378758403|ref|YP_005296407.1| psbM gene product
           (chloroplast) [Oryza meridionalis]
           gi|383931184|ref|YP_006073098.1| photosystem II protein
           M (chloroplast) [Elaeis guineensis]
           gi|385153482|ref|YP_006073262.1| photosystem II protein
           M (chloroplast) [Phalaenopsis equestris]
           gi|386799159|ref|YP_006280748.1| psbM gene product
           (chloroplast) [Oryza rufipogon]
           gi|394831096|ref|YP_006503785.1| photosystem II M
           protein (chloroplast) [Datura stramonium]
           gi|400256582|ref|YP_006576109.1| PsbM (chloroplast)
           [Magnolia denudata] gi|404474405|ref|YP_006665774.1|
           photosystem II protein M (chloroplast) [Elodea
           canadensis] gi|404474519|ref|YP_006666024.1| photosystem
           II protein M (chloroplast) [Capsicum annuum]
           gi|435856367|ref|YP_007317242.1| PSII M protein
           (chloroplast) [Camellia sinensis]
           gi|442742957|ref|YP_007353909.1| photosystem II protein
           M (chloroplast) [Tectona grandis]
           gi|443267301|ref|YP_007375037.1| photosystem II protein
           M [Quercus rubra] gi|452848682|ref|YP_007474364.1|
           photosystem II M protein (chloroplast) [Magnolia
           officinalis] gi|452848765|ref|YP_007474446.1|
           photosystem II M protein (chloroplast) [Magnolia
           officinalis subsp. biloba]
           gi|452848850|ref|YP_007474530.1| photosystem II M
           protein (chloroplast) [Magnolia grandiflora]
           gi|452849471|ref|YP_007475128.1| photosystem II protein
           M (chloroplast) [Arundinaria gigantea]
           gi|456061445|ref|YP_007475613.1| photosystem II protein
           M [Heliconia collinsiana]
           gi|456061550|ref|YP_007475698.1| photosystem II protein
           M [Zingiber spectabile] gi|456061652|ref|YP_007475783.1|
           photosystem II protein M [Pseudophoenix vinifera]
           gi|456061764|ref|YP_007475955.1| photosystem II protein
           M [Bismarckia nobilis] gi|456061880|ref|YP_007476041.1|
           photosystem II protein M [Dasypogon bromeliifolius]
           gi|456330886|ref|YP_007475869.1| photosystem II protein
           M [Calamus caryotoides] gi|456330984|ref|YP_007476345.1|
           PsbM (chloroplast) [Trithuria inconspicua]
           gi|459014487|ref|YP_007507105.1| photosystem II M
           protein (chloroplast) [Salvia miltiorrhiza]
           gi|484759639|ref|YP_007889936.1| photosystem II protein
           M (chloroplast) [Pachycladon cheesemanii]
           gi|511348330|ref|YP_008081259.1| photosystem II protein
           M (chloroplast) [Catharanthus roseus]
           gi|511348432|ref|YP_008081359.1| photosystem II protein
           M (chloroplast) [Tetracentron sinense]
           gi|511348525|ref|YP_008081451.1| photosystem II protein
           M (chloroplast) [Trochodendron aralioides]
           gi|519704498|ref|YP_008082575.1| photosystem II protein
           M (chloroplast) [Utricularia gibba]
           gi|529249791|ref|YP_008378780.1| photosystem II protein
           M (chloroplast) [Najas flexilis]
           gi|542688193|ref|YP_008520133.1| photosystem II protein
           M (chloroplast) [Camellia taliensis]
           gi|544163607|ref|YP_008563082.1| photosystem II protein
           M (chloroplast) [Solanum lycopersicum]
           gi|546138053|ref|YP_008578279.1| photosystem II protein
           M (chloroplast) [Cocos nucifera]
           gi|552539667|ref|YP_008592751.1| photosystem II protein
           M (chloroplast) [Camellia cuspidata]
           gi|552540912|ref|YP_008592840.1| photosystem II protein
           M (chloroplast) [Camellia danzaiensis]
           gi|552541009|ref|YP_008592927.1| photosystem II protein
           M (chloroplast) [Camellia impressinervis]
           gi|552541103|ref|YP_008593105.1| photosystem II protein
           M (chloroplast) [Camellia yunnanensis]
           gi|552541297|ref|YP_008592482.1| PSII M protein
           (chloroplast) [Andrographis paniculata]
           gi|552546262|ref|YP_008593016.1| photosystem II protein
           M (chloroplast) [Camellia pitardii]
           gi|558603860|ref|YP_008815931.1| photosystem II protein
           M (chloroplast) [Lindenbergia philippensis]
           gi|563940546|ref|YP_008854419.1| photosystem II protein
           M [Musa textilis] gi|563940649|ref|YP_008854505.1|
           photosystem II protein M [Ravenala madagascariensis]
           gi|567853685|ref|YP_008854588.1| photosystem II protein
           M [Curcuma roscoeana] gi|568244553|ref|YP_008963300.1|
           photosystem II protein M [Camellia oleifera]
           gi|568244728|ref|YP_008963474.1| photosystem II protein
           M (chloroplast) [Penthorum chinense]
           gi|568245193|ref|YP_008964343.1| photosystem II protein
           M [Helianthus divaricatus]
           gi|568245279|ref|YP_008964428.1| photosystem II protein
           M [Helianthus decapetalus]
           gi|568245365|ref|YP_008964683.1| photosystem II protein
           M [Helianthus strumosus]
           gi|568245451|ref|YP_008964768.1| photosystem II protein
           M [Helianthus maximiliani]
           gi|568247097|ref|YP_008964028.1| photosystem II protein
           M [Ajuga reptans] gi|568247143|ref|YP_008964173.1|
           photosystem II protein M [Helianthus giganteus]
           gi|568247229|ref|YP_008964258.1| photosystem II protein
           M [Helianthus grosseserratus]
           gi|568247315|ref|YP_008964513.1| photosystem II protein
           M [Helianthus hirsutus] gi|568247401|ref|YP_008964598.1|
           photosystem II protein M [Helianthus tuberosus]
           gi|570700303|ref|YP_008993963.1| photosystem II protein
           M (chloroplast) [Pharus lappulaceus]
           gi|570759745|ref|YP_008993170.1| photosystem II protein
           M (chloroplast) [Magnolia cathcartii]
           gi|570759832|ref|YP_008993256.1| photosystem II protein
           M (chloroplast) [Magnolia dealbata]
           gi|570759919|ref|YP_008993342.1| photosystem II protein
           M (chloroplast) [Magnolia pyramidata]
           gi|570760006|ref|YP_008993428.1| photosystem II protein
           M (chloroplast) [Magnolia kobus]
           gi|570760093|ref|YP_008993514.1| photosystem II protein
           M (chloroplast) [Magnolia liliifera]
           gi|570760178|ref|YP_008993600.1| photosystem II protein
           M (chloroplast) [Magnolia odora]
           gi|570772190|ref|YP_008993772.1| photosystem II protein
           M (chloroplast) [Magnolia sinica]
           gi|570772288|ref|YP_008993858.1| photosystem II protein
           M (chloroplast) [Magnolia sprengeri]
           gi|573972368|ref|YP_008993686.1| photosystem II protein
           M (chloroplast) [Magnolia salicifolia]
           gi|575669204|ref|YP_008964861.1| photosystem II protein
           M (chloroplast) [Schwalbea americana]
           gi|575925624|ref|YP_009000009.1| photosystem II protein
           M (chloroplast) [Silene conoidea]
           gi|576312286|ref|YP_009000170.1| photosystem II protein
           M (chloroplast) [Silene paradoxa]
           gi|576999541|ref|YP_009000090.1| photosystem II protein
           M (chloroplast) [Silene chalcedonica]
           gi|586929220|ref|YP_009001981.1| photosystem II protein
           M (chloroplast) [Puelia olyriformis]
           gi|587005072|ref|YP_009002252.1| photosystem II protein
           M (chloroplast) [Pinguicula ehlersiae]
           gi|544170665|ref|AP_004922.1| photosystem II protein M
           (chloroplast) [Solanum lycopersicum]
           gi|49065803|sp|P62109.1|PSBM_ARATH RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|49065805|sp|P62111.1|PSBM_TOBAC RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|49065806|sp|P62112.1|PSBM_SPIOL RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|61214668|sp|Q5IBK3.1|PSBM_PLALA RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|61214952|sp|Q6ENI6.1|PSBM_ORYNI RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|61214968|sp|Q6EW54.1|PSBM_NYMAL RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|61215132|sp|Q7FNT0.1|PSBM_ATRBE RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|122164447|sp|Q06H03.1|PSBM_DRIGR
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|122164979|sp|Q06RD7.1|PSBM_JASNU
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|122166041|sp|Q09G52.1|PSBM_PLAOC
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|122179586|sp|Q1KXX3.1|PSBM_HELAN
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|122201791|sp|Q2MIA6.1|PSBM_SOLLC
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|122201833|sp|Q2MIJ3.1|PSBM_SOLBU
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|122209898|sp|Q2VEI2.1|PSBM_SOLTU
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|122212913|sp|Q33C43.1|PSBM_NICTO
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|122213441|sp|Q3BAP6.1|PSBM_PHAAO
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|122213539|sp|Q3C1G4.1|PSBM_NICSY
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|122217422|sp|Q3V540.1|PSBM_ACOCL
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|122233821|sp|Q0G9M5.1|PSBM_LIRTU
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|148887148|sp|P0C411.1|PSBM_ORYSA
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|148887149|sp|P0C412.1|PSBM_ORYSI
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|148887150|sp|P0C413.1|PSBM_ORYSJ
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|171769948|sp|A7Y3C1.1|PSBM_IPOPU
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|172044402|sp|A4QJS7.1|PSBM_OLIPU
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|172044406|sp|A4QK99.1|PSBM_BARVE
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|172044408|sp|A4QKI6.1|PSBM_CAPBU
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|172044410|sp|A4QKS5.1|PSBM_CRUWA
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|172044414|sp|A4QLA0.1|PSBM_LEPVR
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|172044418|sp|A4QLS7.1|PSBM_NASOF
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|172048415|sp|A9L990.1|PSBM_LEMMI
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|172048676|sp|A6MM30.1|PSBM_BUXMI
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|172048685|sp|A6MMB6.1|PSBM_CHLSC
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|172048694|sp|A6MMK1.1|PSBM_DIOEL
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|172048703|sp|A6MMT8.1|PSBM_ILLOL
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|19920159|gb|AAM08591.1|AC092750_25
           Putative PSII low MW protein from chromosome 10
           chloroplast insertion [Oryza sativa Japonica Group]
           gi|21327351|gb|AAM48256.1|AC122148_9 Putative PSII low
           MW protein from chromosome 10 chloroplast insertion
           [Oryza sativa Japonica Group] gi|11969|emb|CAA33984.1|
           PSII low MW protein [Oryza sativa Japonica Group]
           gi|2924261|emb|CAA77413.1| PSII M-protein [Nicotiana
           tabacum] gi|5881688|dbj|BAA84379.1| PSII low MW protein
           [Arabidopsis thaliana] gi|7636099|emb|CAB88719.1| PSII
           M-protein [Spinacia oleracea]
           gi|20068325|emb|CAC88038.1| PSII M protein [Atropa
           belladonna] gi|21628656|emb|CAD36619.1| photosystem II
           polypeptide M [Quercus petraea]
           gi|49614983|dbj|BAD26766.1| PSII low MW protein [Oryza
           nivara] gi|50250321|emb|CAF28587.1| PSII low MW protein
           [Nymphaea alba] gi|57115540|gb|AAW33074.1| photosystem
           II protein M [Plantago australis]
           gi|57115543|gb|AAW33076.1| photosystem II protein M
           [Plantago coronopus] gi|57115546|gb|AAW33078.1|
           photosystem II protein M [Plantago lanceolata]
           gi|57115549|gb|AAW33080.1| photosystem II protein M
           [Plantago media] gi|57115552|gb|AAW33082.1| photosystem
           II protein M [Plantago rigida]
           gi|57115555|gb|AAW33084.1| photosystem II protein M
           [Plantago rugelii] gi|58802777|gb|AAW82497.1|
           photosystem II M protein [Phalaenopsis aphrodite subsp.
           formosana] gi|69217310|gb|AAZ04027.1| photosystem II
           protein M [Acorus americanus] gi|69217314|gb|AAZ04029.1|
           photosystem II protein M [Nuphar advena]
           gi|69217316|gb|AAZ04030.1| photosystem II protein M
           [Ranunculus macranthus] gi|69217318|gb|AAZ04031.1|
           photosystem II protein M [Typha latifolia]
           gi|72011389|gb|AAZ66142.1| PsbM [Symplocos chinensis]
           gi|72011392|gb|AAZ66144.1| PsbM [Symplocos paniculata]
           gi|72011398|gb|AAZ66148.1| PsbM [Symplocos celastrinea]
           gi|72011404|gb|AAZ66152.1| PsbM [Symplocos pentandra]
           gi|72011410|gb|AAZ66156.1| PsbM [Symplocos tinctoria]
           gi|72011413|gb|AAZ66158.1| PsbM [Symplocos lanata]
           gi|72011419|gb|AAZ66162.1| PsbM [Symplocos
           austin-smithii] gi|72011422|gb|AAZ66164.1| PsbM
           [Symplocos austin-smithii] gi|72011425|gb|AAZ66166.1|
           PsbM [Symplocos austromexicana]
           gi|72011428|gb|AAZ66168.1| PsbM [Symplocos berteroi]
           gi|72011431|gb|AAZ66170.1| PsbM [Symplocos breedlovei]
           gi|72011434|gb|AAZ66172.1| PsbM [Symplocos citrea]
           gi|72011437|gb|AAZ66174.1| PsbM [Symplocos coccinea]
           gi|72011440|gb|AAZ66176.1| PsbM [Symplocos costaricana]
           gi|72011443|gb|AAZ66178.1| PsbM [Symplocos fuscata]
           gi|72011446|gb|AAZ66180.1| PsbM [Symplocos hartwegii]
           gi|72011449|gb|AAZ66182.1| PsbM [Symplocos limoncillo]
           gi|72011452|gb|AAZ66184.1| PsbM [Symplocos
           martinicensis] gi|72011455|gb|AAZ66186.1| PsbM
           [Symplocos matudae] gi|72011458|gb|AAZ66188.1| PsbM
           [Symplocos nitens] gi|72011461|gb|AAZ66190.1| PsbM
           [Symplocos povedae] gi|72011470|gb|AAZ66196.1| PsbM
           [Symplocos reflexa] gi|72011473|gb|AAZ66198.1| PsbM
           [Symplocos serrulata] gi|72011482|gb|AAZ66204.1| PsbM
           [Symplocos sp. Clark et al. 8252]
           gi|72011488|gb|AAZ66208.1| PsbM [Symplocos striata]
           gi|72011491|gb|AAZ66210.1| PsbM [Symplocos sulcinervia]
           gi|72011497|gb|AAZ66214.1| PsbM [Symplocos
           tribracteolata] gi|72011500|gb|AAZ66216.1| PsbM
           [Symplocos uniflora] gi|72011503|gb|AAZ66218.1| PsbM
           [Symplocos verrucisurcula] gi|72011506|gb|AAZ66220.1|
           PsbM [Symplocos candelabra] gi|72011509|gb|AAZ66222.1|
           PsbM [Symplocos falcata] gi|72011512|gb|AAZ66224.1| PsbM
           [Symplocos falcata] gi|72011515|gb|AAZ66226.1| PsbM
           [Symplocos organensis] gi|72011518|gb|AAZ66228.1| PsbM
           [Symplocos microstyla] gi|72011524|gb|AAZ66232.1| PsbM
           [Symplocos dryophila] gi|72011527|gb|AAZ66234.1| PsbM
           [Symplocos lancifolia] gi|72011530|gb|AAZ66236.1| PsbM
           [Symplocos macrophylla] gi|72011539|gb|AAZ66242.1| PsbM
           [Symplocos ovatilobata] gi|72011554|gb|AAZ66252.1| PsbM
           [Symplocos phyllocalyx] gi|72011557|gb|AAZ66254.1| PsbM
           [Symplocos setchuensis] gi|72011560|gb|AAZ66256.1| PsbM
           [Symplocos tetragona] gi|72011563|gb|AAZ66258.1| PsbM
           [Symplocos arborea] gi|72011578|gb|AAZ66268.1| PsbM
           [Symplocos sumuntia] gi|72011584|gb|AAZ66272.1| PsbM
           [Symplocos adenophylla] gi|72011587|gb|AAZ66274.1| PsbM
           [Symplocos congesta] gi|72011590|gb|AAZ66276.1| PsbM
           [Symplocos euryoides] gi|72011599|gb|AAZ66282.1| PsbM
           [Symplocos glomerata] gi|72011602|gb|AAZ66284.1| PsbM
           [Symplocos grandis] gi|72011605|gb|AAZ66286.1| PsbM
           [Symplocos stellaris] gi|72011608|gb|AAZ66288.1| PsbM
           [Symplocos caerulescens] gi|74381703|emb|CAI53788.1|
           PSII low MW protein [Acorus calamus]
           gi|77799553|dbj|BAE46642.1| PSII M-protein [Nicotiana
           sylvestris] gi|80750916|dbj|BAE47992.1| PSII M-protein
           [Nicotiana tomentosiformis] gi|82754623|gb|ABB90037.1|
           photosystem II M protein [Solanum tuberosum]
           gi|84371889|gb|ABC56207.1| photosystem II protein M
           [Solanum bulbocastanum] gi|84371977|gb|ABC56294.1|
           photosystem II protein M (chloroplast) [Solanum
           lycopersicum] gi|84682198|gb|ABC60452.1| photosystem II
           protein M [Nuphar advena] gi|85540798|gb|ABC70750.1|
           photosystem II protein M [Ranunculus macranthus]
           gi|88656798|gb|ABD47051.1| photosystem II protein M
           [Solanum tuberosum] gi|88656881|gb|ABD47132.1|
           photosystem II protein M [Helianthus annuus]
           gi|88696764|gb|ABD48489.1| PSII M protein [Lemna minor]
           gi|89241665|emb|CAJ32387.1| photosystem II protein M
           [Solanum lycopersicum] gi|110456217|gb|ABG74622.1| PSII
           M protein [Jasminum nudiflorum]
           gi|112032656|gb|ABH88291.1| photosystem II protein M
           [Drimys granadensis] gi|113200988|gb|ABI32503.1|
           photosystem II protein M [Liriodendron tulipifera]
           gi|114054378|gb|ABI49772.1| photosystem II protein M
           [Platanus occidentalis] gi|134286306|dbj|BAF49933.1|
           PSII low MW protein [Olimarabidopsis pumila]
           gi|134286479|dbj|BAF50104.1| PSII low MW protein
           [Barbarea verna] gi|134286567|dbj|BAF50191.1| PSII low
           MW protein [Capsella bursa-pastoris]
           gi|134286657|dbj|BAF50280.1| PSII low MW protein
           [Crucihimalaya wallichii] gi|134286834|dbj|BAF50455.1|
           PSII low MW protein [Lepidium virginicum]
           gi|134287013|dbj|BAF50632.1| PSII low MW protein
           [Nasturtium officinale] gi|146744182|gb|ABQ43254.1|
           photosystem II protein M [Chloranthus spicatus]
           gi|146762279|gb|ABQ45243.1| photosystem II protein M
           [Buxus microphylla] gi|147917389|gb|ABQ52513.1|
           photosystem II protein M [Illicium oligandrum]
           gi|148668040|gb|ABR01424.1| photosystem II protein M
           [Dioscorea elephantipes] gi|156598156|gb|ABU85342.1|
           photosystem II protein M [Elaeis oleifera]
           gi|156598348|gb|ABU85434.1| photosystem II protein M
           [Musa acuminata] gi|156598649|gb|ABU85580.1| photosystem
           II protein M [Scaevola aemula]
           gi|157056752|gb|ABV02342.1| photosystem II protein M
           [Ipomoea purpurea] gi|160369847|gb|ABX38738.1|
           photosystem II protein M [Acorus americanus]
           gi|166065351|gb|ABY79726.1| photosystem II protein M
           [Fagopyrum esculentum subsp. ancestrale]
           gi|179366242|gb|ACB86513.1| photosystem II protein M
           [Guizotia abyssinica] gi|224474128|gb|ACN49317.1|
           photosystem II protein M [Nelumbo lutea]
           gi|224474216|gb|ACN49402.1| photosystem II protein M
           [Nelumbo nucifera] gi|226933876|gb|ACO92009.1|
           photosystem II protein M [Megaleranthis saniculifolia]
           gi|246367055|gb|ACS94666.1| PsbM [Bambusa oldhamii]
           gi|251765240|gb|ACT15394.1| photosystem II protein M
           [Anomochloa marantoidea] gi|255040248|gb|ACT99908.1|
           photosystem II protein M [Dendrocalamus latiflorus]
           gi|281371766|gb|ADA63693.1| photosystem II protein M
           [Typha latifolia] gi|281428681|gb|ADA69920.1|
           photosystem II protein M (chloroplast) [Olea europaea]
           gi|290488066|gb|ADD30417.1| photosystem II protein M
           [Antirrhinum majus] gi|290488070|gb|ADD30419.1|
           photosystem II protein M [Dillenia indica]
           gi|290488072|gb|ADD30420.1| photosystem II protein M
           [Ehretia acuminata] gi|290488074|gb|ADD30421.1|
           photosystem II protein M [Ilex cornuta]
           gi|290488078|gb|ADD30423.1| photosystem II protein M
           [Meliosma aff. cuneifolia Moore 333]
           gi|290488080|gb|ADD30424.1| photosystem II protein M
           [Nelumbo nucifera] gi|290488082|gb|ADD30425.1|
           photosystem II protein M [Nerium oleander]
           gi|290488090|gb|ADD30429.1| photosystem II protein M
           [Berberidopsis corallina] gi|290488100|gb|ADD30434.1|
           photosystem II protein M [Gunnera manicata]
           gi|290488106|gb|ADD30437.1| photosystem II protein M
           [Oxalis latifolia] gi|290488110|gb|ADD30439.1|
           photosystem II protein M [Quercus nigra]
           gi|290488114|gb|ADD30441.1| photosystem II protein M
           [Trochodendron aralioides] gi|290790911|gb|ADD63166.1|
           photosystem II protein M (chloroplast) [Phoenix
           dactylifera] gi|291059247|gb|ADD72083.1| photosystem II
           protein M [Olea europaea] gi|294620571|gb|ADF28140.1|
           photosystem II protein M (chloroplast) [Phoenix
           dactylifera] gi|302424174|gb|ADL39050.1| photosystem II
           protein M [Magnolia kwangsiensis]
           gi|307133875|gb|ADN32880.1| photosystem II protein M
           [Phyllostachys nigra var. henonis]
           gi|308742591|gb|ADO33442.1| photosystem II protein M
           [Smilax china] gi|309321514|gb|ADO65054.1| photosystem
           II protein M [Castanea mollissima]
           gi|309321606|gb|ADO65131.1| photosystem II protein M
           [Acidosasa purpurea] gi|309321690|gb|ADO65214.1|
           photosystem II protein M [Ferrocalamus rimosivaginus]
           gi|309321774|gb|ADO65297.1| photosystem II protein M
           [Indocalamus longiauritus] gi|309321857|gb|ADO65379.1|
           photosystem II protein M [Phyllostachys edulis]
           gi|309321942|gb|ADO65463.1| photosystem II protein M
           [Bambusa emeiensis] gi|310941543|dbj|BAJ24022.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310941545|dbj|BAJ24023.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310941547|dbj|BAJ24024.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310941549|dbj|BAJ24025.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310941551|dbj|BAJ24026.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310941553|dbj|BAJ24027.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310941555|dbj|BAJ24028.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310941557|dbj|BAJ24029.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310941559|dbj|BAJ24030.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310941561|dbj|BAJ24031.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310941563|dbj|BAJ24032.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310941565|dbj|BAJ24033.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310941567|dbj|BAJ24034.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310941569|dbj|BAJ24035.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310941571|dbj|BAJ24036.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310941573|dbj|BAJ24037.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310941575|dbj|BAJ24038.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310941577|dbj|BAJ24039.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310941579|dbj|BAJ24040.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310941581|dbj|BAJ24041.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310941583|dbj|BAJ24042.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310941585|dbj|BAJ24043.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310941587|dbj|BAJ24044.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310941589|dbj|BAJ24045.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310941591|dbj|BAJ24046.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310941593|dbj|BAJ24047.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310941595|dbj|BAJ24048.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310941597|dbj|BAJ24049.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310941599|dbj|BAJ24050.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310941601|dbj|BAJ24051.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310941603|dbj|BAJ24052.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310942017|dbj|BAJ24053.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310942019|dbj|BAJ24054.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310942021|dbj|BAJ24055.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310942023|dbj|BAJ24056.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310942025|dbj|BAJ24057.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310942027|dbj|BAJ24058.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310942029|dbj|BAJ24059.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310942031|dbj|BAJ24060.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310942033|dbj|BAJ24061.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310942035|dbj|BAJ24062.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310942037|dbj|BAJ24063.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310942039|dbj|BAJ24064.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310942041|dbj|BAJ24065.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310942043|dbj|BAJ24066.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310942045|dbj|BAJ24067.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310942047|dbj|BAJ24068.1|
           photosystem II protein M [Lysionotus pauciflorus]
           gi|310942049|dbj|BAJ24069.1| photosystem II protein M
           [Lysionotus pauciflorus] gi|310942051|dbj|BAJ24070.1|
           photosystem II protein M [Lysionotus chingii]
           gi|310942053|dbj|BAJ24071.1| photosystem II protein M
           [Lysionotus chingii] gi|310942055|dbj|BAJ24072.1|
           photosystem II protein M [Lysionotus chingii]
           gi|310942057|dbj|BAJ24073.1| photosystem II protein M
           [Lysionotus oblongifolius] gi|310942059|dbj|BAJ24074.1|
           photosystem II protein M [Lysionotus oblongifolius]
           gi|310942061|dbj|BAJ24075.1| photosystem II protein M
           [Lysionotus oblongifolius] gi|310942063|dbj|BAJ24076.1|
           photosystem II protein M [Lysionotus denticulosus]
           gi|310942065|dbj|BAJ24077.1| photosystem II protein M
           [Lysionotus denticulosus] gi|310942067|dbj|BAJ24078.1|
           photosystem II protein M [Lysionotus serratus]
           gi|321575346|gb|ADW94715.1| PsbM [Streptocarpus
           papangae] gi|321575349|gb|ADW94717.1| PsbM
           [Streptocarpus montanus] gi|321575352|gb|ADW94719.1|
           PsbM [Streptocarpus fanniniae]
           gi|321575354|gb|ADW94720.1| PsbM [Streptocarpus
           pusillus] gi|321575357|gb|ADW94722.1| PsbM
           [Streptocarpus dunnii] gi|321575360|gb|ADW94724.1| PsbM
           [Streptocarpus dunnii] gi|321575363|gb|ADW94726.1| PsbM
           [Streptocarpus dunnii] gi|321575366|gb|ADW94728.1| PsbM
           [Streptocarpus dunnii] gi|321575369|gb|ADW94730.1| PsbM
           [Streptocarpus dunnii] gi|321575372|gb|ADW94732.1| PsbM
           [Streptocarpus dunnii] gi|321575375|gb|ADW94734.1| PsbM
           [Streptocarpus dunnii] gi|321575378|gb|ADW94736.1| PsbM
           [Streptocarpus denticulatus] gi|321575381|gb|ADW94738.1|
           PsbM [Streptocarpus denticulatus]
           gi|321575384|gb|ADW94740.1| PsbM [Streptocarpus grandis]
           gi|321575387|gb|ADW94742.1| PsbM [Streptocarpus grandis]
           gi|321575390|gb|ADW94744.1| PsbM [Streptocarpus
           vandeleurii] gi|321575393|gb|ADW94746.1| PsbM
           [Streptocarpus vandeleurii] gi|321575396|gb|ADW94748.1|
           PsbM [Streptocarpus rimicola]
           gi|321575399|gb|ADW94750.1| PsbM [Streptocarpus
           rimicola] gi|321575402|gb|ADW94752.1| PsbM
           [Streptocarpus bolusii] gi|321575405|gb|ADW94754.1| PsbM
           [Streptocarpus bolusii] gi|321575408|gb|ADW94756.1| PsbM
           [Streptocarpus porphyrostachys]
           gi|321575411|gb|ADW94757.1| PsbM [Streptocarpus
           polyanthus] gi|321575416|gb|ADW94759.1| PsbM
           [Streptocarpus saundersii] gi|321575419|gb|ADW94761.1|
           PsbM [Streptocarpus candidus]
           gi|321575422|gb|ADW94763.1| PsbM [Streptocarpus
           gardenii] gi|321575425|gb|ADW94765.1| PsbM
           [Streptocarpus gardenii] gi|321575428|gb|ADW94767.1|
           PsbM [Streptocarpus gardenii]
           gi|321575431|gb|ADW94769.1| PsbM [Streptocarpus
           gardenii] gi|321575434|gb|ADW94771.1| PsbM
           [Streptocarpus gardenii] gi|321575437|gb|ADW94773.1|
           PsbM [Streptocarpus gardenii]
           gi|321575439|gb|ADW94774.1| PsbM [Streptocarpus
           kentaniensis] gi|321575442|gb|ADW94776.1| PsbM
           [Streptocarpus lilliputana] gi|321575445|gb|ADW94778.1|
           PsbM [Streptocarpus lilliputana]
           gi|321575448|gb|ADW94780.1| PsbM [Streptocarpus aylae]
           gi|321575451|gb|ADW94782.1| PsbM [Streptocarpus
           caeruleus] gi|321575454|gb|ADW94784.1| PsbM
           [Streptocarpus caeruleus] gi|321575457|gb|ADW94786.1|
           PsbM [Streptocarpus longiflorus]
           gi|321575460|gb|ADW94788.1| PsbM [Streptocarpus
           parviflorus] gi|321575463|gb|ADW94790.1| PsbM
           [Streptocarpus parviflorus subsp. parviflorus]
           gi|321575466|gb|ADW94792.1| PsbM [Streptocarpus cyaneus
           subsp. nigridens] gi|321575469|gb|ADW94794.1| PsbM
           [Streptocarpus cyaneus] gi|321575472|gb|ADW94796.1| PsbM
           [Streptocarpus cyaneus] gi|321575475|gb|ADW94798.1| PsbM
           [Streptocarpus floribundus] gi|321575477|gb|ADW94799.1|
           PsbM [Streptocarpus meyeri] gi|321575480|gb|ADW94801.1|
           PsbM [Streptocarpus meyeri] gi|321575483|gb|ADW94803.1|
           PsbM [Streptocarpus meyeri] gi|321575486|gb|ADW94805.1|
           PsbM [Streptocarpus meyeri] gi|321575489|gb|ADW94807.1|
           PsbM [Streptocarpus meyeri] gi|321575492|gb|ADW94809.1|
           PsbM [Streptocarpus meyeri] gi|321575496|gb|ADW94810.1|
           PsbM [Streptocarpus meyeri] gi|321575498|gb|ADW94811.1|
           PsbM [Streptocarpus meyeri] gi|321575502|gb|ADW94813.1|
           PsbM [Streptocarpus meyeri] gi|321575505|gb|ADW94815.1|
           PsbM [Streptocarpus meyeri] gi|321575508|gb|ADW94817.1|
           PsbM [Streptocarpus meyeri] gi|321575511|gb|ADW94819.1|
           PsbM [Streptocarpus meyeri] gi|321575514|gb|ADW94821.1|
           PsbM [Streptocarpus meyeri] gi|321575516|gb|ADW94822.1|
           PsbM [Streptocarpus meyeri] gi|321575518|gb|ADW94823.1|
           PsbM [Streptocarpus meyeri] gi|321575535|gb|ADW94832.1|
           PsbM [Streptocarpus baudertii]
           gi|321575538|gb|ADW94834.1| PsbM [Streptocarpus
           johannis] gi|321575541|gb|ADW94836.1| PsbM
           [Streptocarpus johannis] gi|321575545|gb|ADW94837.1|
           PsbM [Streptocarpus johannis]
           gi|321575548|gb|ADW94838.1| PsbM [Streptocarpus
           johannis] gi|321575551|gb|ADW94840.1| PsbM
           [Streptocarpus modestus] gi|321575554|gb|ADW94842.1|
           PsbM [Streptocarpus modestus]
           gi|321575558|gb|ADW94844.1| PsbM [Streptocarpus
           formosus] gi|321575561|gb|ADW94846.1| PsbM
           [Streptocarpus formosus] gi|321575564|gb|ADW94848.1|
           PsbM [Streptocarpus formosus]
           gi|321575567|gb|ADW94850.1| PsbM [Streptocarpus
           formosus] gi|321575570|gb|ADW94852.1| PsbM
           [Streptocarpus primulifolius]
           gi|321575573|gb|ADW94854.1| PsbM [Streptocarpus
           primulifolius] gi|321575576|gb|ADW94856.1| PsbM
           [Streptocarpus primulifolius]
           gi|321575579|gb|ADW94858.1| PsbM [Streptocarpus
           primulifolius] gi|321575582|gb|ADW94860.1| PsbM
           [Streptocarpus primulifolius]
           gi|321575585|gb|ADW94862.1| PsbM [Streptocarpus
           primulifolius] gi|321575588|gb|ADW94864.1| PsbM
           [Streptocarpus primulifolius]
           gi|321575590|gb|ADW94865.1| PsbM [Streptocarpus
           primulifolius] gi|321575595|gb|ADW94866.1| PsbM
           [Streptocarpus primulifolius]
           gi|321575601|gb|ADW94867.1| PsbM [Streptocarpus
           primulifolius] gi|321575603|gb|ADW94868.1| PsbM
           [Streptocarpus primulifolius]
           gi|321575608|gb|ADW94869.1| PsbM [Streptocarpus rexii]
           gi|321575610|gb|ADW94870.1| PsbM [Streptocarpus rexii]
           gi|321575614|gb|ADW94871.1| PsbM [Streptocarpus rexii]
           gi|321575618|gb|ADW94872.1| PsbM [Streptocarpus rexii]
           gi|325305702|gb|ADZ10863.1| photosystem II protein M
           (chloroplast) [Elaeis guineensis]
           gi|328795427|emb|CBR30309.1| photosystem II protein M
           [Olea europaea subsp. europaea]
           gi|329124576|gb|AEB72133.1| photosystem II protein M
           (chloroplast) [Solanum tuberosum]
           gi|329124663|gb|AEB72219.1| photosystem II protein M
           (chloroplast) [Solanum tuberosum]
           gi|329668847|gb|AEB96294.1| photosystem II protein M
           (chloroplast) [Phalaenopsis equestris]
           gi|329755433|gb|AEC03997.1| photosystem II protein M
           (chloroplast) [Silene conica]
           gi|329755515|gb|AEC04078.1| photosystem II protein M
           (chloroplast) [Silene latifolia]
           gi|329755597|gb|AEC04159.1| photosystem II protein M
           (chloroplast) [Silene noctiflora]
           gi|329755680|gb|AEC04241.1| photosystem II protein M
           (chloroplast) [Silene vulgaris]
           gi|334084395|emb|CBR23823.1| photosystem II protein M
           [Olea europaea subsp. cuspidata]
           gi|334084481|emb|CBR24614.1| photosystem II protein M
           [Olea europaea subsp. europaea]
           gi|334084567|emb|CBR30400.1| photosystem II protein M
           [Olea europaea subsp. europaea]
           gi|334084653|emb|CBS29344.1| photosystem II protein M
           [Olea woodiana subsp. woodiana]
           gi|334084858|emb|CBS29231.1| photosystem II protein M
           [Olea europaea subsp. maroccana]
           gi|334084944|emb|CBJ04292.1| photosystem II protein M
           [Olea europaea subsp. cuspidata]
           gi|334085030|emb|CBR23732.1| photosystem II protein M
           [Olea europaea subsp. cuspidata]
           gi|334089659|gb|AEG64542.1| photosystem II protein M
           (chloroplast) [Ageratina adenophora]
           gi|336326827|gb|AEI53005.1| photosystem II protein M
           (chloroplast) [Oryza meridionalis]
           gi|336326903|gb|AEI53080.1| photosystem II protein M
           (chloroplast) [Oryza rufipogon]
           gi|336326981|gb|AEI53157.1| photosystem II protein M
           (chloroplast) [Oryza rufipogon]
           gi|337730900|gb|AEI70794.1| photosystem II protein M
           [Puelia olyriformis] gi|340536633|gb|AEK48400.1|
           photosystem II protein M (chloroplast) [Colocasia
           esculenta] gi|340536720|gb|AEK48486.1| photosystem II
           protein M (chloroplast) [Colocasia esculenta]
           gi|340549401|gb|AEK53223.1| photosystem II protein M
           (chloroplast) [Boea hygrometrica]
           gi|341834065|gb|AEK94336.1| photosystem II protein M
           [Spirodela polyrhiza] gi|341834149|gb|AEK94419.1|
           photosystem II protein M [Wolffiella lingulata]
           gi|341834233|gb|AEK94502.1| photosystem II protein M
           [Wolffia australiana] gi|343887533|gb|AEM65212.1| PsbM
           [Magnolia denudata] gi|346228292|gb|AEO21166.1|
           photosystem II protein M [Leersia tisserantii]
           gi|346228376|gb|AEO21249.1| photosystem II protein M
           (chloroplast) [Phyllostachys propinqua]
           gi|346228460|gb|AEO21332.1| photosystem II protein M
           [Rhynchoryza subulata] gi|347448289|gb|AEO92700.1| PSII
           M protein (chloroplast) [Sesamum indicum]
           gi|347453896|gb|AEO95554.1| photosystem II protein M
           (chloroplast) [Nicotiana undulata]
           gi|347454007|gb|AEO95664.1| photosystem II protein M
           [synthetic construct] gi|350996420|gb|AEQ36932.1|
           photosystem II M protein (chloroplast) [Datura
           stramonium] gi|350996507|gb|AEQ37018.1| photosystem II M
           protein [Datura stramonium] gi|353685043|gb|AER12808.1|
           photosystem II protein M (chloroplast) [Oryza sativa
           Indica Group] gi|353685209|gb|AER12973.1| photosystem II
           protein M (chloroplast) [Oryza sativa Indica Group]
           gi|353742605|dbj|BAL04669.1| photosystem II reaction
           center protein M [Isodon shikokianus var. occidentalis]
           gi|353742608|dbj|BAL04671.1| photosystem II reaction
           center protein M [Isodon shikokianus var. intermedius]
           gi|353742611|dbj|BAL04673.1| photosystem II reaction
           center protein M [Isodon japonicus]
           gi|353742614|dbj|BAL04675.1| photosystem II reaction
           center protein M [Isodon trichocarpus]
           gi|353742617|dbj|BAL04677.1| photosystem II reaction
           center protein M [Isodon effusus]
           gi|353742620|dbj|BAL04679.1| photosystem II reaction
           center protein M [Isodon shikokianus var. intermedius]
           gi|353742623|dbj|BAL04681.1| photosystem II reaction
           center protein M [Isodon effusus]
           gi|353742626|dbj|BAL04683.1| photosystem II reaction
           center protein M [Isodon umbrosus]
           gi|353742629|dbj|BAL04685.1| photosystem II reaction
           center protein M [Isodon trichocarpus]
           gi|353742632|dbj|BAL04687.1| photosystem II reaction
           center protein M [Isodon inflexus]
           gi|353742635|dbj|BAL04689.1| photosystem II reaction
           center protein M [Isodon inflexus]
           gi|353742638|dbj|BAL04691.1| photosystem II reaction
           center protein M [Isodon shikokianus var. occidentalis]
           gi|353742641|dbj|BAL04693.1| photosystem II reaction
           center protein M [Isodon longitubus]
           gi|353742644|dbj|BAL04695.1| photosystem II reaction
           center protein M [Isodon japonicus]
           gi|353742647|dbj|BAL04697.1| photosystem II reaction
           center protein M [Isodon excisus]
           gi|353742650|dbj|BAL04699.1| photosystem II reaction
           center protein M [Isodon longitubus]
           gi|371572064|gb|AEX37335.1| photosystem II protein M
           (chloroplast) [Arbutus unedo]
           gi|372000623|gb|AEX65388.1| photosystem II protein M
           [Blossfeldia liliputana] gi|372000625|gb|AEX65389.1|
           photosystem II protein M [Didierea madagascariensis]
           gi|372000629|gb|AEX65391.1| photosystem II protein M
           [Mollugo verticillata] gi|372000635|gb|AEX65394.1|
           photosystem II protein M [Pereskiopsis diguetii]
           gi|372862245|gb|AEX98328.1| photosystem II M protein
           (chloroplast) [Magnolia denudata]
           gi|372862415|gb|AEX98496.1| photosystem II M protein
           (chloroplast) [Magnolia officinalis]
           gi|372862498|gb|AEX98578.1| photosystem II M protein
           (chloroplast) [Magnolia officinalis subsp. biloba]
           gi|372862583|gb|AEX98662.1| photosystem II M protein
           (chloroplast) [Magnolia officinalis subsp. biloba]
           gi|372862668|gb|AEX98746.1| photosystem II M protein
           (chloroplast) [Magnolia officinalis subsp. biloba]
           gi|372862837|gb|AEX98913.1| photosystem II M protein
           (chloroplast) [Magnolia grandiflora]
           gi|372863007|gb|AEX99081.1| photosystem II M protein
           (chloroplast) [Magnolia grandiflora]
           gi|374094590|gb|AEY84646.1| photosystem II protein M
           (chloroplast) [Elodea canadensis]
           gi|374257013|gb|AEZ01421.1| photosystem II protein M
           (chloroplast) [Japonolirion osense]
           gi|374962496|gb|AFA26836.1| photosystem II protein M
           [Albuca kirkii] gi|374962502|gb|AFA26839.1| photosystem
           II protein M, partial [Belosynapsis ciliata]
           gi|374962504|gb|AFA26840.1| photosystem II protein M,
           partial [Brocchinia micrantha]
           gi|374962506|gb|AFA26841.1| photosystem II protein M
           [Centrolepis monogyna] gi|374962508|gb|AFA26842.1|
           photosystem II protein M, partial [Chamaedorea
           seifrizii] gi|374962514|gb|AFA26845.1| photosystem II
           protein M [Dasypogon bromeliifolius]
           gi|374962522|gb|AFA26849.1| photosystem II protein M,
           partial [Fosterella caulescens]
           gi|374962534|gb|AFA26855.1| photosystem II protein M
           [Juncus effusus] gi|374962536|gb|AFA26856.1| photosystem
           II protein M, partial [Kingia australis]
           gi|374962542|gb|AFA26859.1| photosystem II protein M,
           partial [Navia saxicola] gi|374962546|gb|AFA26861.1|
           photosystem II protein M, partial [Neoregelia carolinae]
           gi|374962554|gb|AFA26865.1| photosystem II protein M,
           partial [Pitcairnia feliciana]
           gi|374962556|gb|AFA26866.1| photosystem II protein M,
           partial [Potarophytum riparium]
           gi|374962558|gb|AFA26867.1| photosystem II protein M,
           partial [Puya laxa] gi|374962560|gb|AFA26868.1|
           photosystem II protein M, partial [Ravenea
           hildebrandtii] gi|374962562|gb|AFA26869.1| photosystem
           II protein M, partial [Renealmia alpinia]
           gi|374962564|gb|AFA26870.1| photosystem II protein M,
           partial [Sparganium eurycarpum]
           gi|374962566|gb|AFA26871.1| photosystem II protein M
           [Syngonanthus chrysanthus] gi|374962568|gb|AFA26872.1|
           photosystem II protein M [Thamnochortus insignis]
           gi|374962572|gb|AFA26874.1| photosystem II protein M,
           partial [Tradescantia ohiensis]
           gi|383286791|gb|AFH01441.1| photosystem II protein M
           (chloroplast) [Nelumbo nucifera]
           gi|383286886|gb|AFH01535.1| photosystem II protein M
           (chloroplast) [Nelumbo lutea]
           gi|388893201|gb|AFK81293.1| photosystem II protein M
           [Camellia sinensis var. assamica]
           gi|388893289|gb|AFK81380.1| photosystem II protein M
           [Camellia oleifera] gi|388893377|gb|AFK81467.1|
           photosystem II protein M [Camellia taliensis]
           gi|392841332|gb|AFM83287.1| photosystem II protein M
           (chloroplast) [Kingia australis]
           gi|392934147|gb|AFM92273.1| photosystem II protein M
           (chloroplast) [Pachycladon cheesemanii]
           gi|401065926|gb|AFP90770.1| photosystem II protein M
           (chloroplast) [Capsicum annuum]
           gi|401879736|gb|AFQ30923.1| photosystem II M protein
           (chloroplast) [Salvia miltiorrhiza]
           gi|403226775|gb|AFR25654.1| photosystem II protein M
           (chloroplast) [Penthorum chinense]
           gi|408898183|gb|AFU93998.1| PsbM, partial (chloroplast)
           [Medusagyne oppositifolia] gi|408898199|gb|AFU94006.1|
           PsbM, partial (chloroplast) [Rhizophora mangle]
           gi|410176149|gb|AFV61808.1| PSII M protein (chloroplast)
           [Origanum vulgare subsp. vulgare]
           gi|427920150|gb|AFY64181.1| photosystem II protein M
           (chloroplast) [Najas flexilis]
           gi|430728266|gb|AGA55590.1| PSII M protein (chloroplast)
           [Camellia sinensis] gi|438687598|emb|CCP47124.1|
           photosystem II protein M (chloroplast) [Tectona grandis]
           gi|438688282|emb|CCP47213.1| photosystem II protein M
           (chloroplast) [Tectona grandis]
           gi|438688406|emb|CCP47302.1| photosystem II protein M
           (chloroplast) [Tectona grandis]
           gi|441421916|gb|AGC31240.1| photosystem II protein M
           [Quercus rubra] gi|441480239|gb|AGC38151.1| photosystem
           II protein M (chloroplast) [Arundinaria gigantea]
           gi|449020247|gb|AGE65744.1| photosystem II protein M
           (chloroplast) [Pharus lappulaceus]
           gi|449326092|gb|AGE92678.1| photosystem II protein M
           [Heliconia collinsiana] gi|449326178|gb|AGE92763.1|
           photosystem II protein M [Zingiber spectabile]
           gi|449326264|gb|AGE92848.1| photosystem II protein M
           [Pseudophoenix vinifera] gi|449326351|gb|AGE92934.1|
           photosystem II protein M [Calamus caryotoides]
           gi|449326438|gb|AGE93020.1| photosystem II protein M
           [Bismarckia nobilis] gi|449326525|gb|AGE93106.1|
           photosystem II protein M [Dasypogon bromeliifolius]
           gi|449326699|gb|AGE93278.1| photosystem II protein M
           [Chamaedorea seifrizii] gi|449326786|gb|AGE93364.1|
           photosystem II protein M [Alpinia zerumbet]
           gi|449326873|gb|AGE93450.1| photosystem II protein M
           [Xiphidium caeruleum] gi|449713835|emb|CCJ32511.1| PsbM
           (chloroplast) [Trithuria inconspicua]
           gi|469473991|gb|AGH33761.1| photosystem II protein M
           (chloroplast) [Puelia olyriformis]
           gi|474452070|gb|AGI51138.1| photosystem II protein M
           (chloroplast) [Catharanthus roseus]
           gi|478733639|gb|AGJ51250.1| photosystem II protein M
           (chloroplast) [Solanum carolinense]
           gi|479279197|gb|AGJ72051.1| photosystem II protein M
           (chloroplast) [Tetracentron sinense]
           gi|479279290|gb|AGJ72143.1| photosystem II protein M
           (chloroplast) [Trochodendron aralioides]
           gi|496538595|gb|AGL45330.1| PsbM (chloroplast) [Sesamum
           indicum] gi|498921848|gb|AGL61069.1| photosystem II
           protein M (chloroplast) [Utricularia gibba]
           gi|510934398|emb|CCQ09096.1| photosystem II protein M
           (chloroplast) [Olea europaea subsp. europaea]
           gi|519666906|gb|AGO98518.1| photosystem II protein M
           (chloroplast) [Nelumbo nucifera]
           gi|523706685|gb|AGQ55669.1| photosystem II protein M
           (chloroplast) [Alstroemeria aurea]
           gi|525312451|emb|CCW72369.1| psbM (chloroplast) [Musa
           acuminata subsp. malaccensis]
           gi|528748770|gb|AGS43460.1| photosystem II protein M
           (chloroplast) [Cocos nucifera]
           gi|532164830|gb|AGT79840.1| PSII M protein (chloroplast)
           [Andrographis paniculata] gi|537362485|gb|AGU44293.1|
           photosystem II protein M (chloroplast) [Camellia
           cuspidata] gi|537362571|gb|AGU44378.1| photosystem II
           protein M (chloroplast) [Camellia danzaiensis]
           gi|537362663|gb|AGU44469.1| photosystem II protein M
           (chloroplast) [Camellia impressinervis]
           gi|537362753|gb|AGU44558.1| photosystem II protein M
           (chloroplast) [Camellia taliensis]
           gi|537362843|gb|AGU44647.1| photosystem II protein M
           (chloroplast) [Camellia pitardii]
           gi|537362933|gb|AGU44736.1| photosystem II protein M
           (chloroplast) [Camellia yunnanensis]
           gi|537363023|gb|AGU44825.1| photosystem II protein M
           (chloroplast) [Camellia taliensis]
           gi|546352424|gb|AGW96331.1| photosystem II protein M
           (chloroplast) [Ipomoea batatas]
           gi|546352510|gb|AGW96416.1| photosystem II protein M
           (chloroplast) [Ipomoea batatas]
           gi|546352596|gb|AGW96501.1| photosystem II protein M
           (chloroplast) [Ipomoea batatas]
           gi|546352682|gb|AGW96586.1| photosystem II protein M
           (chloroplast) [Ipomoea trifida]
           gi|546352767|gb|AGW96670.1| photosystem II protein M
           (chloroplast) [Argyreia nervosa]
           gi|546352853|gb|AGW96755.1| photosystem II protein M
           (chloroplast) [Ipomoea amnicola]
           gi|546352939|gb|AGW96840.1| photosystem II protein M
           (chloroplast) [Ipomoea argillicola]
           gi|546353025|gb|AGW96925.1| photosystem II protein M
           (chloroplast) [Ipomoea cairica]
           gi|546353111|gb|AGW97010.1| photosystem II protein M
           (chloroplast) [Ipomoea diamantinensis]
           gi|546353283|gb|AGW97180.1| photosystem II protein M
           (chloroplast) [Ipomoea eriocarpa]
           gi|546353369|gb|AGW97265.1| photosystem II protein M
           (chloroplast) [Ipomoea hederifolia]
           gi|546353455|gb|AGW97350.1| photosystem II protein M
           (chloroplast) [Ipomoea involucrata]
           gi|546353541|gb|AGW97435.1| photosystem II protein M
           (chloroplast) [Ipomoea murucoides]
           gi|546353627|gb|AGW97520.1| photosystem II protein M
           (chloroplast) [Ipomoea nil] gi|546353713|gb|AGW97605.1|
           photosystem II protein M (chloroplast) [Ipomoea
           orizabensis] gi|546353799|gb|AGW97690.1| photosystem II
           protein M (chloroplast) [Ipomoea pedicellaris]
           gi|546353885|gb|AGW97775.1| photosystem II protein M
           (chloroplast) [Ipomoea pes-caprae]
           gi|546353971|gb|AGW97860.1| photosystem II protein M
           (chloroplast) [Ipomoea polpha]
           gi|546354057|gb|AGW97945.1| photosystem II protein M
           (chloroplast) [Ipomoea setosa]
           gi|546354142|gb|AGW98029.1| photosystem II protein M
           (chloroplast) [Ipomoea splendor-sylvae]
           gi|546354228|gb|AGW98114.1| photosystem II protein M
           (chloroplast) [Ipomoea ternifolia]
           gi|546354314|gb|AGW98199.1| photosystem II protein M
           (chloroplast) [Ipomoea tricolor]
           gi|546354400|gb|AGW98284.1| photosystem II protein M
           (chloroplast) [Ipomoea trifida]
           gi|546354486|gb|AGW98369.1| photosystem II protein M
           (chloroplast) [Ipomoea cordatotriloba]
           gi|546354572|gb|AGW98454.1| photosystem II protein M
           (chloroplast) [Ipomoea minutiflora]
           gi|546354658|gb|AGW98539.1| photosystem II protein M
           (chloroplast) [Ipomoea obscura]
           gi|546354744|gb|AGW98624.1| photosystem II protein M
           (chloroplast) [Ipomoea pes-tigridis]
           gi|546354830|gb|AGW98709.1| photosystem II protein M
           (chloroplast) [Merremia quinquefolia]
           gi|546354916|gb|AGW98794.1| photosystem II protein M
           (chloroplast) [Operculina macrocarpa]
           gi|546355002|gb|AGW98879.1| photosystem II protein M
           (chloroplast) [Stictocardia macalusoi]
           gi|546355088|gb|AGW98964.1| photosystem II protein M
           (chloroplast) [Turbina corymbosa]
           gi|555944096|gb|AGZ17999.1| photosystem II protein M
           (chloroplast) [Silene conoidea]
           gi|555944178|gb|AGZ18080.1| photosystem II protein M
           (chloroplast) [Silene chalcedonica]
           gi|555944259|gb|AGZ18160.1| photosystem II protein M
           (chloroplast) [Silene paradoxa]
           gi|555945910|gb|AGZ19137.1| photosystem II protein M
           (chloroplast) [Camellia sinensis]
           gi|555945976|gb|AGZ19202.1| photosystem II protein M
           (chloroplast) [Oryza rufipogon]
           gi|557136857|emb|CDI43912.1| photosystem II protein M
           (chloroplast) [Lindenbergia philippensis]
           gi|557636906|gb|AHA12508.1| photosystem II protein M
           [Musa textilis] gi|557636993|gb|AHA12594.1| photosystem
           II protein M [Ravenala madagascariensis]
           gi|557637077|gb|AHA12677.1| photosystem II protein M
           [Orchidantha fimbriata] gi|557637150|gb|AHA12749.1|
           photosystem II protein M [Canna indica]
           gi|557637235|gb|AHA12833.1| photosystem II protein M
           [Maranta leuconeura] gi|557637321|gb|AHA12918.1|
           photosystem II protein M [Monocostus uniflorus]
           gi|557637408|gb|AHA13004.1| photosystem II protein M
           [Costus pulverulentus] gi|557637495|gb|AHA13090.1|
           photosystem II protein M [Curcuma roscoeana]
           gi|557637582|gb|AHA13176.1| photosystem II protein M
           [Thaumatococcus daniellii] gi|558697168|gb|AHA84923.1|
           photosystem II protein M [Ajuga reptans]
           gi|559768001|gb|AHB14443.1| photosystem II protein M
           [Helianthus giganteus] gi|559768087|gb|AHB14528.1|
           photosystem II protein M [Helianthus giganteus]
           gi|559768173|gb|AHB14613.1| photosystem II protein M
           [Helianthus giganteus] gi|559768259|gb|AHB14698.1|
           photosystem II protein M [Helianthus giganteus]
           gi|559768345|gb|AHB14783.1| photosystem II protein M
           [Helianthus grosseserratus] gi|559768431|gb|AHB14868.1|
           photosystem II protein M [Helianthus grosseserratus]
           gi|559768517|gb|AHB14953.1| photosystem II protein M
           [Helianthus divaricatus] gi|559768603|gb|AHB15038.1|
           photosystem II protein M [Helianthus divaricatus]
           gi|559768689|gb|AHB15123.1| photosystem II protein M
           [Helianthus divaricatus] gi|559768775|gb|AHB15208.1|
           photosystem II protein M [Helianthus divaricatus]
           gi|559768861|gb|AHB15293.1| photosystem II protein M
           [Helianthus decapetalus] gi|559768947|gb|AHB15378.1|
           photosystem II protein M [Helianthus decapetalus]
           gi|559769033|gb|AHB15463.1| photosystem II protein M
           [Helianthus decapetalus] gi|559769119|gb|AHB15548.1|
           photosystem II protein M [Helianthus hirsutus]
           gi|559769205|gb|AHB15633.1| photosystem II protein M
           [Helianthus hirsutus] gi|559769291|gb|AHB15718.1|
           photosystem II protein M [Helianthus tuberosus]
           gi|559769377|gb|AHB15803.1| photosystem II protein M
           [Helianthus tuberosus] gi|559769463|gb|AHB15888.1|
           photosystem II protein M [Helianthus tuberosus]
           gi|559769549|gb|AHB15973.1| photosystem II protein M
           [Helianthus divaricatus] gi|559769635|gb|AHB16058.1|
           photosystem II protein M [Helianthus giganteus]
           gi|559769721|gb|AHB16143.1| photosystem II protein M
           [Helianthus giganteus] gi|559769807|gb|AHB16228.1|
           photosystem II protein M [Helianthus grosseserratus]
           gi|559769893|gb|AHB16313.1| photosystem II protein M
           [Helianthus grosseserratus] gi|559769979|gb|AHB16398.1|
           photosystem II protein M [Helianthus grosseserratus]
           gi|559770065|gb|AHB16483.1| photosystem II protein M
           [Helianthus grosseserratus] gi|559770151|gb|AHB16568.1|
           photosystem II protein M [Helianthus decapetalus]
           gi|559770237|gb|AHB16653.1| photosystem II protein M
           [Helianthus decapetalus] gi|559770323|gb|AHB16738.1|
           photosystem II protein M [Helianthus decapetalus]
           gi|559770409|gb|AHB16823.1| photosystem II protein M
           [Helianthus hirsutus] gi|559770495|gb|AHB16908.1|
           photosystem II protein M [Helianthus hirsutus]
           gi|559770581|gb|AHB16993.1| photosystem II protein M
           [Helianthus strumosus] gi|559770667|gb|AHB17078.1|
           photosystem II protein M [Helianthus tuberosus]
           gi|559770753|gb|AHB17163.1| photosystem II protein M
           [Helianthus tuberosus] gi|559770839|gb|AHB17248.1|
           photosystem II protein M [Helianthus tuberosus]
           gi|559770925|gb|AHB17333.1| photosystem II protein M
           [Helianthus maximiliani] gi|559771011|gb|AHB17418.1|
           photosystem II protein M [Helianthus maximiliani]
           gi|559771097|gb|AHB17503.1| photosystem II protein M
           [Helianthus maximiliani] gi|559771183|gb|AHB17588.1|
           photosystem II protein M [Helianthus maximiliani]
           gi|560176694|emb|CDJ38613.1| photosystem II protein M
           (chloroplast) [Schwalbea americana]
           gi|563322717|gb|AHB38648.1| photosystem II protein M
           (chloroplast) [Trithuria filamentosa]
           gi|573461945|emb|CCQ71614.1| photosystem II protein M
           (chloroplast) [Salvia miltiorrhiza]
           gi|575882134|emb|CDL78808.1| photosystem II protein M
           (chloroplast) [Pinguicula ehlersiae]
           gi|576090117|gb|AHH24327.1| photosystem II protein M
           (chloroplast) [Japonolirion osense]
           gi|576598273|gb|AHH30435.1| photosystem II protein M
           (chloroplast) [Bartsia inaequalis]
           gi|584297175|gb|AHI87521.1| photosystem II protein M
           (chloroplast) [Chionographis japonica]
           gi|226687|prf||1603356M photosystem II low MW protein
          Length = 34

 Score = 66.6 bits (161), Expect = 3e-09
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 194 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 295
           MEVNILAFIATALFILVPTAFLLIIYVKTVSQND
Sbjct: 1   MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 34


>gb|ADD30418.1| photosystem II protein M [Aucuba japonica]
           gi|290488076|gb|ADD30422.1| photosystem II protein M
           [Lonicera japonica] gi|290488094|gb|ADD30431.1|
           photosystem II protein M [Cornus florida]
          Length = 34

 Score = 66.2 bits (160), Expect = 4e-09
 Identities = 33/34 (97%), Positives = 34/34 (100%)
 Frame = +2

Query: 194 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 295
           MEVNILAFIATALFILVPTAFLLIIYVKT+SQND
Sbjct: 1   MEVNILAFIATALFILVPTAFLLIIYVKTISQND 34


>ref|YP_740644.1| photosystem II protein M [Nandina domestica]
           gi|139389258|ref|YP_001123024.1| PSII low MW protein
           [Aethionema grandiflorum]
           gi|139390342|ref|YP_001122940.1| PSII low MW protein
           [Aethionema cordifolium]
           gi|159106852|ref|YP_001531271.1| psbM gene product
           (chloroplast) [Lolium perenne]
           gi|218176233|ref|YP_002364490.1| photosystem II protein
           M [Festuca arundinacea] gi|426406627|ref|YP_007026541.1|
           photosystem II protein M [Festuca ovina]
           gi|427436963|ref|YP_007026455.1| photosystem II protein
           M [Festuca altissima] gi|427437060|ref|YP_007026627.1|
           photosystem II protein M [Festuca pratensis]
           gi|427437206|ref|YP_007026713.1| photosystem II protein
           M [Lolium multiflorum] gi|428697634|ref|YP_007025906.1|
           photosystem II protein M [Vaccinium macrocarpon]
           gi|552546083|ref|YP_008592633.1| photosystem II protein
           M (chloroplast) [Berberis bealei]
           gi|122165967|sp|Q09FW7.1|PSBM_NANDO RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|172044398|sp|A4QJA9.1|PSBM_AETCO
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|172044400|sp|A4QJJ3.1|PSBM_AETGR
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|172048168|sp|A8Y9F8.1|PSBM_LOLPR
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|114054464|gb|ABI49857.1| photosystem II
           protein M [Nandina domestica]
           gi|134286135|dbj|BAF49764.1| PSII low MW protein
           [Aethionema cordifolium] gi|134286220|dbj|BAF49848.1|
           PSII low MW protein [Aethionema grandiflorum]
           gi|158934386|emb|CAO85964.1| photosystem II protein M
           (chloroplast) [Lolium perenne]
           gi|215882317|gb|ACJ70747.1| photosystem II protein M
           [Festuca arundinacea] gi|290488086|gb|ADD30427.1|
           photosystem II protein M [Rhododendron simsii]
           gi|374093716|gb|AEY84152.1| photosystem II protein M
           (chloroplast) [Vaccinium macrocarpon]
           gi|385198143|gb|AFI44061.1| photosystem II protein M
           [Vaccinium macrocarpon] gi|410177754|gb|AFV62635.1|
           photosystem II protein M [Festuca altissima]
           gi|410177841|gb|AFV62721.1| photosystem II protein M
           [Festuca ovina] gi|410177928|gb|AFV62807.1| photosystem
           II protein M [Festuca pratensis]
           gi|410178015|gb|AFV62893.1| photosystem II protein M
           [Lolium multiflorum] gi|536462674|gb|AGU37039.1|
           photosystem II protein M (chloroplast) [Berberis bealei]
          Length = 34

 Score = 66.2 bits (160), Expect = 4e-09
 Identities = 33/34 (97%), Positives = 34/34 (100%)
 Frame = +2

Query: 194 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 295
           MEVNILAFIATALFIL+PTAFLLIIYVKTVSQND
Sbjct: 1   MEVNILAFIATALFILIPTAFLLIIYVKTVSQND 34


>ref|YP_008578533.1| photosystem II protein M (chloroplast) [Asclepias nivea]
           gi|545907186|ref|YP_008578618.1| photosystem II protein
           M (chloroplast) [Asclepias syriaca]
           gi|326200275|gb|ADZ52314.1| photosystem II protein M
           [Asclepias syriaca] gi|355331718|gb|AER52407.1|
           photosystem II protein M [Asclepias albicans]
           gi|355331801|gb|AER52489.1| photosystem II protein M
           [Asclepias albicans] gi|355331884|gb|AER52571.1|
           photosystem II protein M [Asclepias coulteri]
           gi|355331967|gb|AER52653.1| photosystem II protein M
           [Asclepias cutleri] gi|355332050|gb|AER52735.1|
           photosystem II protein M [Asclepias cutleri]
           gi|355332133|gb|AER52817.1| photosystem II protein M
           [Asclepias leptopus] gi|355332215|gb|AER52898.1|
           photosystem II protein M [Asclepias macrotis]
           gi|355332296|gb|AER52978.1| photosystem II protein M
           [Asclepias macrotis] gi|355332375|gb|AER53056.1|
           photosystem II protein M [Asclepias masonii]
           gi|355332458|gb|AER53138.1| photosystem II protein M
           [Asclepias subaphylla] gi|355332541|gb|AER53220.1|
           photosystem II protein M [Asclepias subaphylla]
           gi|355332620|gb|AER53298.1| photosystem II protein M
           [Asclepias subulata] gi|355332703|gb|AER53380.1|
           photosystem II protein M [Asclepias subulata]
           gi|355332786|gb|AER53462.1| photosystem II protein M
           [Asclepias albicans x Asclepias subulata]
           gi|544186411|gb|AGW04358.1| photosystem II protein M
           [Araujia sericifera] gi|544186489|gb|AGW04435.1|
           photosystem II protein M [Astephanus triflorus]
           gi|544186718|gb|AGW04661.1| photosystem II protein M
           [Matelea biflora] gi|544186796|gb|AGW04738.1|
           photosystem II protein M [Orthosia scoparia]
           gi|544187030|gb|AGW04969.1| photosystem II protein M
           [Vincetoxicum rossicum] gi|544187175|gb|AGW05113.1|
           photosystem II protein M (chloroplast) [Asclepias nivea]
           gi|544187203|gb|AGW05131.1| photosystem II protein M
           (chloroplast) [Asclepias syriaca]
          Length = 34

 Score = 65.9 bits (159), Expect = 6e-09
 Identities = 32/34 (94%), Positives = 34/34 (100%)
 Frame = +2

Query: 194 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 295
           MEVNILAF+ATALFILVPTAFLLIIYVKT+SQND
Sbjct: 1   MEVNILAFVATALFILVPTAFLLIIYVKTISQND 34


>ref|YP_008994562.1| photosystem II protein M (chloroplast) [Pelargonium alternans]
           gi|540067641|gb|AGV02991.1| photosystem II protein M
           (chloroplast) [Pelargonium alternans]
          Length = 37

 Score = 65.5 bits (158), Expect = 7e-09
 Identities = 34/36 (94%), Positives = 35/36 (97%)
 Frame = +2

Query: 194 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND*F 301
           MEVNILAFIATALFILVPTAFLLIIYVKTVSQ+D F
Sbjct: 1   MEVNILAFIATALFILVPTAFLLIIYVKTVSQSDSF 36


>ref|YP_008080492.1| photosystem II protein M (chloroplast) [Pharus latifolius]
           gi|336280791|gb|AEI29079.1| photosystem II protein M
           (chloroplast) [Pharus latifolius]
          Length = 34

 Score = 65.5 bits (158), Expect = 7e-09
 Identities = 33/34 (97%), Positives = 34/34 (100%)
 Frame = +2

Query: 194 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 295
           MEVNI+AFIATALFILVPTAFLLIIYVKTVSQND
Sbjct: 1   MEVNIVAFIATALFILVPTAFLLIIYVKTVSQND 34


>ref|XP_002888353.1| hypothetical protein ARALYDRAFT_893970 [Arabidopsis lyrata subsp.
           lyrata] gi|297334194|gb|EFH64612.1| hypothetical protein
           ARALYDRAFT_893970 [Arabidopsis lyrata subsp. lyrata]
          Length = 120

 Score = 62.4 bits (150), Expect(2) = 8e-09
 Identities = 30/42 (71%), Positives = 34/42 (80%)
 Frame = -1

Query: 301 ELIILTDCFYVNDK*KSGRN*NE*CSSNKCKNIYFHNLIGFF 176
           +LIILT+ FYVN K KS RN NE C SNKCKNIYFHNLI ++
Sbjct: 66  KLIILTNGFYVNYKQKSSRNENEECGSNKCKNIYFHNLIVYY 107



 Score = 23.1 bits (48), Expect(2) = 8e-09
 Identities = 8/12 (66%), Positives = 11/12 (91%)
 Frame = -3

Query: 182 FFYFAITRDLIP 147
           +F+F I+RDLIP
Sbjct: 109 YFFFLISRDLIP 120


>ref|NP_043013.1| photosystem II protein M [Zea mays] gi|48478761|ref|YP_024369.1|
           photosystem II protein M [Saccharum hybrid cultivar
           SP-80-3280] gi|50812516|ref|YP_054619.1| photosystem II
           protein M [Saccharum hybrid cultivar NCo 310]
           gi|118614480|ref|YP_899395.1| photosystem II protein M
           [Sorghum bicolor] gi|260677408|ref|YP_003208176.1|
           photosystem II protein M [Coix lacryma-jobi]
           gi|281190715|ref|YP_003330952.1| photosystem II protein
           M [Parthenium argentatum]
           gi|345895205|ref|YP_004841937.1| photosystem II protein
           M [Panicum virgatum] gi|558603659|ref|YP_008815739.1|
           photosystem II protein M [Setaria italica]
           gi|563354768|ref|YP_008855079.1| photosystem II protein
           M (chloroplast) [Phragmites australis]
           gi|1346867|sp|P48189.1|PSBM_MAIZE RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|61214875|sp|Q672I5.1|PSBM_PENAM RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|61214960|sp|Q6ENX5.1|PSBM_SACOF RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|75261498|sp|Q6L3A9.1|PSBM_SACHY RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|125980974|sp|A1E9R2.1|PSBM_SORBI
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|902210|emb|CAA60274.1| PSII low MW
           protein [Zea mays] gi|48478663|gb|AAT44683.1|
           photosystem II M protein [Saccharum hybrid cultivar
           SP80-3280] gi|49659500|dbj|BAD27281.1| PSII M-protein
           [Saccharum hybrid cultivar NCo 310]
           gi|51872079|gb|AAU12167.1| photosystem II low MW protein
           [Cenchrus americanus] gi|118201114|gb|ABK79484.1|
           photosystem II protein M [Sorghum bicolor]
           gi|209361346|gb|ACI43261.1| photosystem II protein M
           [Coix lacryma-jobi] gi|269924828|gb|ACZ52701.1|
           photosystem II protein M [Parthenium argentatum]
           gi|307697275|gb|ADN86092.1| photosystem II protein M
           [Chasmanthium latifolium] gi|319412307|gb|ADV41843.1|
           photosystem II protein M (chloroplast) [Panicum
           virgatum] gi|319412394|gb|ADV41929.1| photosystem II
           protein M (chloroplast) [Panicum virgatum]
           gi|374962518|gb|AFA26847.1| photosystem II protein M,
           partial [Eleusine coracana] gi|441480323|gb|AGC38234.1|
           photosystem II protein M (chloroplast) [Cryptochloa
           strictiflora] gi|555298031|gb|AGZ13133.1| photosystem II
           protein M [Setaria italica] gi|558614278|gb|AHA82288.1|
           photosystem II protein M (chloroplast) [Phragmites
           australis]
          Length = 34

 Score = 65.1 bits (157), Expect = 9e-09
 Identities = 33/34 (97%), Positives = 33/34 (97%)
 Frame = +2

Query: 194 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 295
           MEVNILAFIATALFILVPTAFLLIIYVKT SQND
Sbjct: 1   MEVNILAFIATALFILVPTAFLLIIYVKTASQND 34


>gb|AGW04281.1| photosystem II protein M [Secamone afzelii]
          Length = 34

 Score = 65.1 bits (157), Expect = 9e-09
 Identities = 32/34 (94%), Positives = 34/34 (100%)
 Frame = +2

Query: 194 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 295
           MEVNILAFIATALFI+VPTAFLLIIYVKT+SQND
Sbjct: 1   MEVNILAFIATALFIVVPTAFLLIIYVKTISQND 34


>ref|YP_006666287.1| photosystem II protein M (chloroplast) [Pachycladon enysii]
           gi|401786720|gb|AFQ07786.1| photosystem II protein M
           (chloroplast) [Pachycladon enysii]
          Length = 34

 Score = 65.1 bits (157), Expect = 9e-09
 Identities = 33/34 (97%), Positives = 34/34 (100%)
 Frame = +2

Query: 194 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 295
           MEVNILAFIATALFILVPTAFLLIIYVKTVSQN+
Sbjct: 1   MEVNILAFIATALFILVPTAFLLIIYVKTVSQNE 34


>ref|YP_005296094.1| psbM gene product (chloroplast) [Pentactina rupicola]
           gi|371532617|gb|AEX31727.1| PSII low MW protein M
           (chloroplast) [Pentactina rupicola]
          Length = 36

 Score = 65.1 bits (157), Expect = 9e-09
 Identities = 34/36 (94%), Positives = 34/36 (94%)
 Frame = +2

Query: 194 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND*F 301
           MEVNILAFIATALFILVPTAFLLIIYVKTVSQ D F
Sbjct: 1   MEVNILAFIATALFILVPTAFLLIIYVKTVSQGDSF 36


>ref|YP_003587462.1| photosystem II protein M [Oncidium hybrid cultivar]
           gi|254833103|gb|ACT83106.1| photosystem II protein M
           [Oncidium hybrid cultivar]
          Length = 37

 Score = 65.1 bits (157), Expect = 9e-09
 Identities = 34/36 (94%), Positives = 34/36 (94%)
 Frame = +2

Query: 194 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND*F 301
           MEVNILA IATALFILVPTAFLLIIYVKTVSQND F
Sbjct: 1   MEVNILALIATALFILVPTAFLLIIYVKTVSQNDEF 36


>ref|YP_001542441.1| photosystem II protein M [Ceratophyllum demersum]
           gi|172048119|sp|A8SE94.1|PSBM_CERDE RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|148508437|gb|ABQ81444.1| photosystem II
           protein M [Ceratophyllum demersum]
           gi|227481113|emb|CAP62492.1| PSII low MW protein
           [Ceratophyllum demersum]
          Length = 34

 Score = 65.1 bits (157), Expect = 9e-09
 Identities = 33/34 (97%), Positives = 34/34 (100%)
 Frame = +2

Query: 194 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 295
           MEVNILAFIATALFILVPTAFLLIIYVKTVS+ND
Sbjct: 1   MEVNILAFIATALFILVPTAFLLIIYVKTVSKND 34


>ref|YP_784467.1| photosystem II protein M [Piper cenocladum]
           gi|122164368|sp|Q06GR6.1|PSBM_PIPCE RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|112253745|gb|ABI14466.1| photosystem II
           protein M [Piper cenocladum]
          Length = 34

 Score = 65.1 bits (157), Expect = 9e-09
 Identities = 33/34 (97%), Positives = 33/34 (97%)
 Frame = +2

Query: 194 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 295
           MEVNILAFIAT LFILVPTAFLLIIYVKTVSQND
Sbjct: 1   MEVNILAFIATVLFILVPTAFLLIIYVKTVSQND 34


>gb|AAZ66146.1| PsbM [Symplocos bogotensis] gi|72011464|gb|AAZ66192.1| PsbM
           [Symplocos pycnantha] gi|72011467|gb|AAZ66194.1| PsbM
           [Symplocos quitensis] gi|72011485|gb|AAZ66206.1| PsbM
           [Symplocos speciosa] gi|72011566|gb|AAZ66260.1| PsbM
           [Symplocos caerulescens] gi|72011572|gb|AAZ66264.1| PsbM
           [Symplocos aff. munda 442]
          Length = 34

 Score = 64.7 bits (156), Expect = 1e-08
 Identities = 33/34 (97%), Positives = 33/34 (97%)
 Frame = +2

Query: 194 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 295
           MEVNILAFIATA FILVPTAFLLIIYVKTVSQND
Sbjct: 1   MEVNILAFIATAXFILVPTAFLLIIYVKTVSQND 34


>ref|YP_398315.1| photosystem II reaction center M protein [Lactuca sativa]
           gi|91983986|ref|YP_567070.1| photosystem II protein M
           [Vitis vinifera] gi|116617102|ref|YP_817476.1|
           photosystem II protein M [Coffea arabica]
           gi|139389636|ref|YP_001123193.1| PSII low MW protein
           [Arabis hirsuta] gi|139389944|ref|YP_001123544.1| PSII
           low MW protein [Draba nemorosa]
           gi|139390146|ref|YP_001123719.1| photosystem II protein
           M [Lobularia maritima] gi|170784766|ref|YP_001718682.1|
           photosystem II protein M [Trachelium caeruleum]
           gi|194033138|ref|YP_002000476.1| photosystem II protein
           M [Brachypodium distachyon]
           gi|334702311|ref|YP_004465174.1| photosystem II protein
           M [Jacobaea vulgaris] gi|383930486|ref|YP_005089946.1|
           psbM gene product (chloroplast) [Brassica napus]
           gi|441403278|ref|YP_007353752.1| photosystem II M
           protein (chloroplast) [Chrysanthemum x morifolium]
           gi|452849037|ref|YP_007474715.1| PsbM (chloroplast)
           [Chrysanthemum indicum] gi|470227694|ref|YP_007624781.1|
           photosystem II reaction center M protein (chloroplast)
           [Artemisia frigida] gi|568244642|ref|YP_008963389.1|
           photosystem II protein M (chloroplast) [Sedum
           sarmentosum] gi|575771000|ref|YP_009000326.1| psbM
           protein (chloroplast) [Arabis alpina]
           gi|576303610|ref|YP_008999929.1| photosystem II protein
           M (chloroplast) [Agrostemma githago]
           gi|68052415|sp|Q56P14.1|PSBM_LACSA RecName:
           Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|122153615|sp|A0A329.1|PSBM_COFAR
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|122236500|sp|Q0ZJ26.1|PSBM_VITVI
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|172044404|sp|A4QK12.1|PSBM_ARAHI
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|172044412|sp|A4QL13.1|PSBM_DRANE
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|172044416|sp|A4QLI8.1|PSBM_LOBMA
           RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M gi|61992020|gb|AAX58141.1| PSII M protein
           [Lactuca sativa] gi|78675154|dbj|BAE47580.1| photosystem
           II reaction center M protein [Lactuca sativa]
           gi|88656969|gb|ABD47219.1| photosystem II protein M
           [Lactuca sativa] gi|91701644|gb|ABE47528.1| photosystem
           II protein M [Vitis vinifera]
           gi|116242158|gb|ABJ89673.1| photosystem II protein M
           [Coffea arabica] gi|134286391|dbj|BAF50017.1| PSII low
           MW protein [Arabis hirsuta] gi|134286746|dbj|BAF50368.1|
           PSII low MW protein [Draba nemorosa]
           gi|134286923|dbj|BAF50543.1| PSII low MW protein
           [Lobularia maritima] gi|156598802|gb|ABU85654.1|
           photosystem II protein M [Trachelium caeruleum]
           gi|157267514|gb|ABV26507.1| photosystem II protein M
           (chloroplast) [Trachelium caeruleum]
           gi|193075546|gb|ACF08629.1| PSII low MW protein
           (chloroplast) [Brachypodium distachyon]
           gi|262400783|gb|ACY66272.1| photosystem II protein M
           [Brassica napus] gi|290488102|gb|ADD30435.1| photosystem
           II protein M [Heuchera sanguinea]
           gi|308156069|gb|ADO15397.1| photosystem II protein M
           [Jacobaea vulgaris] gi|321575521|gb|ADW94825.1| PsbM
           [Streptocarpus montigena] gi|321575524|gb|ADW94827.1|
           PsbM [Streptocarpus montigena]
           gi|321575527|gb|ADW94829.1| PsbM [Streptocarpus
           montigena] gi|321575530|gb|ADW94831.1| PsbM
           [Streptocarpus montigena] gi|372863192|gb|AEX99264.1|
           PsbM (chloroplast) [Chrysanthemum indicum]
           gi|372863431|gb|AEX99500.1| photosystem II M protein
           (chloroplast) [Chrysanthemum indicum]
           gi|374962492|gb|AFA26834.1| photosystem II protein M
           [Abolboda macrostachya] gi|374962520|gb|AFA26848.1|
           photosystem II protein M, partial [Flagellaria indica]
           gi|375298821|gb|AFA45260.1| photosystem II M protein
           (chloroplast) [Chrysanthemum x morifolium]
           gi|401712182|gb|AFP98807.1| photosystem II reaction
           center M protein (chloroplast) [Artemisia frigida]
           gi|402797524|gb|AFQ99056.1| photosystem II protein M
           (chloroplast) [Sedum sarmentosum]
           gi|523582292|gb|AGQ50345.1| photosystem II protein M
           (chloroplast) [Rumex acetosa]
           gi|546353197|gb|AGW97095.1| photosystem II protein M
           (chloroplast) [Ipomoea dumetorum]
           gi|550533642|dbj|BAO01486.1| photosystem II protein M
           (chloroplast) [Vitis vinifera subsp. caucasica]
           gi|550533728|dbj|BAO01570.1| photosystem II protein M
           (chloroplast) [Vitis vinifera subsp. caucasica]
           gi|550533813|dbj|BAO01654.1| photosystem II protein M
           (chloroplast) [Vitis vinifera subsp. caucasica]
           gi|555944015|gb|AGZ17919.1| photosystem II protein M
           (chloroplast) [Agrostemma githago]
           gi|571025798|emb|CCW28173.1| psbM protein (chloroplast)
           [Arabis alpina]
          Length = 34

 Score = 64.7 bits (156), Expect = 1e-08
 Identities = 33/34 (97%), Positives = 34/34 (100%)
 Frame = +2

Query: 194 MEVNILAFIATALFILVPTAFLLIIYVKTVSQND 295
           MEVNILAFIATALFILVPTAFLLIIYVKTVSQN+
Sbjct: 1   MEVNILAFIATALFILVPTAFLLIIYVKTVSQNN 34


Top