BLASTX nr result
ID: Rehmannia25_contig00022050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00022050 (415 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004247408.1| PREDICTED: uncharacterized protein LOC101243... 60 3e-07 gb|EPS62396.1| hypothetical protein M569_12393 [Genlisea aurea] 56 4e-06 ref|XP_006359854.1| PREDICTED: uncharacterized protein LOC102602... 55 7e-06 >ref|XP_004247408.1| PREDICTED: uncharacterized protein LOC101243740 [Solanum lycopersicum] Length = 171 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/37 (72%), Positives = 29/37 (78%), Gaps = 1/37 (2%) Frame = +1 Query: 1 IASADFPVDNFYESPQCGCGFDCVNWGKRNR-KFSFK 108 IASADF +DNFYESPQCGCGFDCVN G+ KF K Sbjct: 129 IASADFAIDNFYESPQCGCGFDCVNSGENGTGKFDLK 165 >gb|EPS62396.1| hypothetical protein M569_12393 [Genlisea aurea] Length = 153 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +1 Query: 1 IASADFPVDNFYESPQCGCGFDCVN 75 + SADFPVD+FYESPQCGCGFDCVN Sbjct: 121 LLSADFPVDSFYESPQCGCGFDCVN 145 >ref|XP_006359854.1| PREDICTED: uncharacterized protein LOC102602991 [Solanum tuberosum] Length = 170 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +1 Query: 1 IASADFPVDNFYESPQCGCGFDCVN 75 IASADF +DNFYESPQCGCGFDCV+ Sbjct: 128 IASADFAIDNFYESPQCGCGFDCVD 152