BLASTX nr result
ID: Rehmannia25_contig00021641
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00021641 (414 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006827367.1| hypothetical protein AMTR_s00011p00100920 [A... 62 8e-08 ref|XP_006348959.1| PREDICTED: callose synthase 7-like [Solanum ... 62 1e-07 gb|EPS72207.1| hypothetical protein M569_02539, partial [Genlise... 62 1e-07 ref|XP_004243209.1| PREDICTED: callose synthase 7-like [Solanum ... 62 1e-07 ref|XP_002307554.1| GLUCAN SYNTHASE-LIKE 11 family protein [Popu... 62 1e-07 ref|XP_006602253.1| PREDICTED: callose synthase 7-like isoform X... 61 1e-07 ref|XP_006602251.1| PREDICTED: callose synthase 7-like isoform X... 61 1e-07 ref|XP_006586073.1| PREDICTED: callose synthase 7-like [Glycine ... 61 1e-07 gb|ESW18333.1| hypothetical protein PHAVU_006G032100g [Phaseolus... 61 1e-07 ref|XP_004499983.1| PREDICTED: callose synthase 7-like [Cicer ar... 61 1e-07 ref|XP_003599819.1| Callose synthase [Medicago truncatula] gi|35... 61 1e-07 gb|EXB92390.1| Callose synthase 7 [Morus notabilis] 60 2e-07 gb|ADK87343.1| callose synthase 7 [Arabidopsis thaliana] 60 2e-07 ref|XP_006417911.1| hypothetical protein EUTSA_v10006529mg [Eutr... 60 2e-07 gb|EOY20145.1| Glucan synthase-like 7 [Theobroma cacao] 60 2e-07 gb|EOX93038.1| Glucan synthase-like 7 [Theobroma cacao] 60 2e-07 gb|EOX93037.1| Glucan synthase-like 7 [Theobroma cacao] 60 2e-07 gb|EMJ16096.1| hypothetical protein PRUPE_ppa000077mg [Prunus pe... 60 2e-07 gb|AAF24822.1|AC007592_15 F12K11.17 [Arabidopsis thaliana] 60 2e-07 ref|NP_172136.2| callose synthase 7 [Arabidopsis thaliana] gi|33... 60 2e-07 >ref|XP_006827367.1| hypothetical protein AMTR_s00011p00100920 [Amborella trichopoda] gi|548831802|gb|ERM94604.1| hypothetical protein AMTR_s00011p00100920 [Amborella trichopoda] Length = 1916 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 3 AIGDFIVMQLQLASVFFTFQLGTQALYYERMILHG 107 A+GDFI+MQLQLASVFFTFQLGT+A YY R ILHG Sbjct: 1563 ALGDFIIMQLQLASVFFTFQLGTKAHYYGRTILHG 1597 >ref|XP_006348959.1| PREDICTED: callose synthase 7-like [Solanum tuberosum] Length = 1911 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 AIGDFIVMQLQLASVFFTFQLGTQALYYERMILHG 107 A+GDF++MQLQLASVFFTFQLGT+A YY R ILHG Sbjct: 1557 ALGDFVIMQLQLASVFFTFQLGTKAHYYGRTILHG 1591 >gb|EPS72207.1| hypothetical protein M569_02539, partial [Genlisea aurea] Length = 1763 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +3 Query: 3 AIGDFIVMQLQLASVFFTFQLGTQALYYERMILHG 107 AIGDFIVMQLQLASVFFTFQLGT+A Y+ R ILHG Sbjct: 1413 AIGDFIVMQLQLASVFFTFQLGTKAHYFGRTILHG 1447 >ref|XP_004243209.1| PREDICTED: callose synthase 7-like [Solanum lycopersicum] Length = 1912 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 AIGDFIVMQLQLASVFFTFQLGTQALYYERMILHG 107 A+GDF++MQLQLASVFFTFQLGT+A YY R ILHG Sbjct: 1558 ALGDFVIMQLQLASVFFTFQLGTKAHYYGRTILHG 1592 >ref|XP_002307554.1| GLUCAN SYNTHASE-LIKE 11 family protein [Populus trichocarpa] gi|222857003|gb|EEE94550.1| GLUCAN SYNTHASE-LIKE 11 family protein [Populus trichocarpa] Length = 1944 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 AIGDFIVMQLQLASVFFTFQLGTQALYYERMILHG 107 A+GDF++MQLQLASVFFTFQLGT+A YY R ILHG Sbjct: 1579 ALGDFVIMQLQLASVFFTFQLGTKAHYYGRTILHG 1613 >ref|XP_006602253.1| PREDICTED: callose synthase 7-like isoform X3 [Glycine max] Length = 1554 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 AIGDFIVMQLQLASVFFTFQLGTQALYYERMILHG 107 A+GDFI+MQLQLASVFFTFQLGT+A YY R +LHG Sbjct: 1200 ALGDFIIMQLQLASVFFTFQLGTKAHYYGRTLLHG 1234 >ref|XP_006602251.1| PREDICTED: callose synthase 7-like isoform X1 [Glycine max] gi|571544714|ref|XP_006602252.1| PREDICTED: callose synthase 7-like isoform X2 [Glycine max] Length = 1918 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 AIGDFIVMQLQLASVFFTFQLGTQALYYERMILHG 107 A+GDFI+MQLQLASVFFTFQLGT+A YY R +LHG Sbjct: 1564 ALGDFIIMQLQLASVFFTFQLGTKAHYYGRTLLHG 1598 >ref|XP_006586073.1| PREDICTED: callose synthase 7-like [Glycine max] Length = 1921 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 AIGDFIVMQLQLASVFFTFQLGTQALYYERMILHG 107 A+GDFI+MQLQLASVFFTFQLGT+A YY R +LHG Sbjct: 1567 ALGDFIIMQLQLASVFFTFQLGTKAHYYGRTLLHG 1601 >gb|ESW18333.1| hypothetical protein PHAVU_006G032100g [Phaseolus vulgaris] Length = 1917 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 AIGDFIVMQLQLASVFFTFQLGTQALYYERMILHG 107 A+GDFI+MQLQLASVFFTFQLGT+A YY R +LHG Sbjct: 1563 ALGDFIIMQLQLASVFFTFQLGTKAHYYGRTLLHG 1597 >ref|XP_004499983.1| PREDICTED: callose synthase 7-like [Cicer arietinum] Length = 1913 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 AIGDFIVMQLQLASVFFTFQLGTQALYYERMILHG 107 A+GDFI+MQLQLASVFFTFQLGT+A YY R +LHG Sbjct: 1559 ALGDFIIMQLQLASVFFTFQLGTKAHYYGRTLLHG 1593 >ref|XP_003599819.1| Callose synthase [Medicago truncatula] gi|355488867|gb|AES70070.1| Callose synthase [Medicago truncatula] Length = 1919 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 AIGDFIVMQLQLASVFFTFQLGTQALYYERMILHG 107 A+GDFI+MQLQLASVFFTFQLGT+A YY R +LHG Sbjct: 1565 ALGDFIIMQLQLASVFFTFQLGTKAHYYGRTLLHG 1599 >gb|EXB92390.1| Callose synthase 7 [Morus notabilis] Length = 1956 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 3 AIGDFIVMQLQLASVFFTFQLGTQALYYERMILHG 107 A+GDFI+MQLQLASVFFTFQLGT+ YY R ILHG Sbjct: 1599 ALGDFIIMQLQLASVFFTFQLGTKVHYYGRTILHG 1633 >gb|ADK87343.1| callose synthase 7 [Arabidopsis thaliana] Length = 1933 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 AIGDFIVMQLQLASVFFTFQLGTQALYYERMILHG 107 A+GDFI+MQLQLASVFFTFQLGT+A Y+ R ILHG Sbjct: 1577 ALGDFIIMQLQLASVFFTFQLGTKAHYFGRTILHG 1611 >ref|XP_006417911.1| hypothetical protein EUTSA_v10006529mg [Eutrema salsugineum] gi|557095682|gb|ESQ36264.1| hypothetical protein EUTSA_v10006529mg [Eutrema salsugineum] Length = 1934 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 AIGDFIVMQLQLASVFFTFQLGTQALYYERMILHG 107 A+GDFI+MQLQLASVFFTFQLGT+A Y+ R ILHG Sbjct: 1577 ALGDFIIMQLQLASVFFTFQLGTKAHYFGRTILHG 1611 >gb|EOY20145.1| Glucan synthase-like 7 [Theobroma cacao] Length = 441 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 AIGDFIVMQLQLASVFFTFQLGTQALYYERMILHG 107 A+GDFI+MQLQLASVFFTFQLGT+A Y+ R ILHG Sbjct: 314 ALGDFIIMQLQLASVFFTFQLGTKAHYFGRTILHG 348 >gb|EOX93038.1| Glucan synthase-like 7 [Theobroma cacao] Length = 1891 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 AIGDFIVMQLQLASVFFTFQLGTQALYYERMILHG 107 A+GDFI+MQLQLASVFFTFQLGT+A Y+ R ILHG Sbjct: 1538 ALGDFIIMQLQLASVFFTFQLGTKAHYFGRTILHG 1572 >gb|EOX93037.1| Glucan synthase-like 7 [Theobroma cacao] Length = 1929 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 AIGDFIVMQLQLASVFFTFQLGTQALYYERMILHG 107 A+GDFI+MQLQLASVFFTFQLGT+A Y+ R ILHG Sbjct: 1570 ALGDFIIMQLQLASVFFTFQLGTKAHYFGRTILHG 1604 >gb|EMJ16096.1| hypothetical protein PRUPE_ppa000077mg [Prunus persica] Length = 1929 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 3 AIGDFIVMQLQLASVFFTFQLGTQALYYERMILHG 107 A+GDFI+MQLQLASVFFTFQLGT+ YY R ILHG Sbjct: 1572 ALGDFIIMQLQLASVFFTFQLGTKVHYYGRTILHG 1606 >gb|AAF24822.1|AC007592_15 F12K11.17 [Arabidopsis thaliana] Length = 1930 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 AIGDFIVMQLQLASVFFTFQLGTQALYYERMILHG 107 A+GDFI+MQLQLASVFFTFQLGT+A Y+ R ILHG Sbjct: 1574 ALGDFIIMQLQLASVFFTFQLGTKAHYFGRTILHG 1608 >ref|NP_172136.2| callose synthase 7 [Arabidopsis thaliana] gi|334302882|sp|Q9SHJ3.3|CALS7_ARATH RecName: Full=Callose synthase 7; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 7 gi|332189872|gb|AEE27993.1| callose synthase 7 [Arabidopsis thaliana] Length = 1958 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 AIGDFIVMQLQLASVFFTFQLGTQALYYERMILHG 107 A+GDFI+MQLQLASVFFTFQLGT+A Y+ R ILHG Sbjct: 1577 ALGDFIIMQLQLASVFFTFQLGTKAHYFGRTILHG 1611