BLASTX nr result
ID: Rehmannia25_contig00021504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00021504 (638 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004160226.1| PREDICTED: cysteine proteinase inhibitor B-l... 47 7e-07 ref|XP_004138536.1| PREDICTED: cysteine proteinase inhibitor B-l... 47 7e-07 ref|XP_006840903.1| hypothetical protein AMTR_s00087p00084520 [A... 44 4e-06 ref|XP_004248025.1| PREDICTED: cysteine proteinase inhibitor 10-... 57 5e-06 ref|XP_006840905.1| hypothetical protein AMTR_s00087p00085650 [A... 44 9e-06 >ref|XP_004160226.1| PREDICTED: cysteine proteinase inhibitor B-like [Cucumis sativus] Length = 128 Score = 46.6 bits (109), Expect(2) = 7e-07 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = +3 Query: 201 GGKFGGRAQVKNVEANKEVQDLGRYCVQEYNR 296 GG+ GGR +VK+V N+EVQ LGR+ V+EYNR Sbjct: 25 GGRVGGRMEVKDVRRNEEVQRLGRFSVEEYNR 56 Score = 33.1 bits (74), Expect(2) = 7e-07 Identities = 12/22 (54%), Positives = 19/22 (86%) Frame = +1 Query: 343 RTFEAVVVVKPWLHSKELLNFA 408 + F++VV+VKPW+ SK LL+F+ Sbjct: 95 KVFDSVVIVKPWIGSKRLLDFS 116 >ref|XP_004138536.1| PREDICTED: cysteine proteinase inhibitor B-like [Cucumis sativus] Length = 128 Score = 46.6 bits (109), Expect(2) = 7e-07 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = +3 Query: 201 GGKFGGRAQVKNVEANKEVQDLGRYCVQEYNR 296 GG+ GGR +VK+V N+EVQ LGR+ V+EYNR Sbjct: 25 GGRVGGRMEVKDVRRNEEVQRLGRFSVEEYNR 56 Score = 33.1 bits (74), Expect(2) = 7e-07 Identities = 12/22 (54%), Positives = 19/22 (86%) Frame = +1 Query: 343 RTFEAVVVVKPWLHSKELLNFA 408 + F++VV+VKPW+ SK LL+F+ Sbjct: 95 KVFDSVVIVKPWIGSKRLLDFS 116 >ref|XP_006840903.1| hypothetical protein AMTR_s00087p00084520 [Amborella trichopoda] gi|548842758|gb|ERN02578.1| hypothetical protein AMTR_s00087p00084520 [Amborella trichopoda] Length = 120 Score = 43.5 bits (101), Expect(2) = 4e-06 Identities = 16/28 (57%), Positives = 25/28 (89%) Frame = +3 Query: 213 GGRAQVKNVEANKEVQDLGRYCVQEYNR 296 GGR+ + NV++N EVQDLG++CV++YN+ Sbjct: 31 GGRSAIPNVKSNTEVQDLGKFCVEKYNQ 58 Score = 33.5 bits (75), Expect(2) = 4e-06 Identities = 13/26 (50%), Positives = 21/26 (80%) Frame = +1 Query: 331 GESSRTFEAVVVVKPWLHSKELLNFA 408 G+ + F+AVVVV+ W HSK++L+F+ Sbjct: 91 GDVLKKFDAVVVVQAWRHSKQMLSFS 116 >ref|XP_004248025.1| PREDICTED: cysteine proteinase inhibitor 10-like [Solanum lycopersicum] Length = 134 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = +3 Query: 201 GGKFGGRAQVKNVEANKEVQDLGRYCVQEYNR 296 GGK GGR Q+KNV+ N+E+QDLG+YCV+E+NR Sbjct: 28 GGKLGGRTQIKNVKTNQEIQDLGKYCVEEHNR 59 >ref|XP_006840905.1| hypothetical protein AMTR_s00087p00085650 [Amborella trichopoda] gi|548842760|gb|ERN02580.1| hypothetical protein AMTR_s00087p00085650 [Amborella trichopoda] Length = 120 Score = 43.9 bits (102), Expect(2) = 9e-06 Identities = 16/30 (53%), Positives = 26/30 (86%) Frame = +3 Query: 207 KFGGRAQVKNVEANKEVQDLGRYCVQEYNR 296 + GGRA++ NV+++ EVQDLG++CV+ YN+ Sbjct: 29 RLGGRAEIPNVKSSTEVQDLGKFCVETYNQ 58 Score = 32.0 bits (71), Expect(2) = 9e-06 Identities = 12/22 (54%), Positives = 19/22 (86%) Frame = +1 Query: 343 RTFEAVVVVKPWLHSKELLNFA 408 + F+AVVVV+ W HSK++L+F+ Sbjct: 95 KKFDAVVVVQAWRHSKQMLSFS 116