BLASTX nr result
ID: Rehmannia25_contig00021478
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00021478 (342 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006430026.1| hypothetical protein CICLE_v10012108mg [Citr... 55 7e-06 ref|XP_006430023.1| hypothetical protein CICLE_v10012108mg [Citr... 55 7e-06 ref|XP_006430022.1| hypothetical protein CICLE_v10012108mg [Citr... 55 7e-06 >ref|XP_006430026.1| hypothetical protein CICLE_v10012108mg [Citrus clementina] gi|567874875|ref|XP_006430027.1| hypothetical protein CICLE_v10012108mg [Citrus clementina] gi|557532083|gb|ESR43266.1| hypothetical protein CICLE_v10012108mg [Citrus clementina] gi|557532084|gb|ESR43267.1| hypothetical protein CICLE_v10012108mg [Citrus clementina] Length = 354 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/59 (47%), Positives = 35/59 (59%) Frame = -3 Query: 241 KGSVVFGRSTKPSLSQSLSFPVRGRHSDIMKRKTEVYPSKSDTNQSQKTVVKVESKVLN 65 KGS F RS +P LSQSL FP RG H+D +K+ +VYP K D Q+ VK + N Sbjct: 103 KGSASFTRSQRPVLSQSLFFPSRGAHADALKKSIDVYPIKRDAKQALVNRVKGQGPSFN 161 >ref|XP_006430023.1| hypothetical protein CICLE_v10012108mg [Citrus clementina] gi|567874871|ref|XP_006430025.1| hypothetical protein CICLE_v10012108mg [Citrus clementina] gi|557532080|gb|ESR43263.1| hypothetical protein CICLE_v10012108mg [Citrus clementina] gi|557532082|gb|ESR43265.1| hypothetical protein CICLE_v10012108mg [Citrus clementina] Length = 345 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/59 (47%), Positives = 35/59 (59%) Frame = -3 Query: 241 KGSVVFGRSTKPSLSQSLSFPVRGRHSDIMKRKTEVYPSKSDTNQSQKTVVKVESKVLN 65 KGS F RS +P LSQSL FP RG H+D +K+ +VYP K D Q+ VK + N Sbjct: 103 KGSASFTRSQRPVLSQSLFFPSRGAHADALKKSIDVYPIKRDAKQALVNRVKGQGPSFN 161 >ref|XP_006430022.1| hypothetical protein CICLE_v10012108mg [Citrus clementina] gi|567874869|ref|XP_006430024.1| hypothetical protein CICLE_v10012108mg [Citrus clementina] gi|557532079|gb|ESR43262.1| hypothetical protein CICLE_v10012108mg [Citrus clementina] gi|557532081|gb|ESR43264.1| hypothetical protein CICLE_v10012108mg [Citrus clementina] Length = 494 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/59 (47%), Positives = 35/59 (59%) Frame = -3 Query: 241 KGSVVFGRSTKPSLSQSLSFPVRGRHSDIMKRKTEVYPSKSDTNQSQKTVVKVESKVLN 65 KGS F RS +P LSQSL FP RG H+D +K+ +VYP K D Q+ VK + N Sbjct: 103 KGSASFTRSQRPVLSQSLFFPSRGAHADALKKSIDVYPIKRDAKQALVNRVKGQGPSFN 161