BLASTX nr result
ID: Rehmannia25_contig00021155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00021155 (578 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74704.1| hypothetical protein M569_00079, partial [Genlise... 75 1e-11 >gb|EPS74704.1| hypothetical protein M569_00079, partial [Genlisea aurea] Length = 88 Score = 75.1 bits (183), Expect = 1e-11 Identities = 36/66 (54%), Positives = 47/66 (71%), Gaps = 1/66 (1%) Frame = -3 Query: 195 LKSMMESVWDLNGYPNRTEPFVRLLFSQSYGVRHRFLNKIHF-LDCMMDSPEKHWHKCTR 19 + +++ V+ G+ NRT+PFV LLFSQSYGVRHR ++I + MM+SPEK W C R Sbjct: 22 ISQIVDGVYFCFGHSNRTKPFVMLLFSQSYGVRHRLQDQISIDFEWMMESPEKPWRACKR 81 Query: 18 GALPTE 1 GALPTE Sbjct: 82 GALPTE 87