BLASTX nr result
ID: Rehmannia25_contig00021143
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00021143 (488 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006366773.1| PREDICTED: endoplasmic oxidoreductin-1-like ... 130 2e-28 ref|XP_004243200.1| PREDICTED: endoplasmic oxidoreductin-1-like ... 130 2e-28 ref|XP_006478010.1| PREDICTED: endoplasmic oxidoreductin-1-like ... 126 3e-27 ref|XP_006478009.1| PREDICTED: endoplasmic oxidoreductin-1-like ... 126 3e-27 ref|XP_006441012.1| hypothetical protein CICLE_v10019948mg [Citr... 126 3e-27 ref|XP_006441011.1| hypothetical protein CICLE_v10019948mg [Citr... 126 3e-27 ref|XP_002298934.2| hypothetical protein POPTR_0001s42700g [Popu... 125 4e-27 ref|XP_006370451.1| Endoplasmic oxidoreductin 1 precursor family... 125 4e-27 ref|XP_002317004.2| Endoplasmic oxidoreductin 1 precursor family... 125 4e-27 gb|EOY27645.1| Endoplasmic reticulum oxidoreductins 1 isoform 2 ... 124 1e-26 gb|EOY27644.1| Endoplasmic reticulum oxidoreductins 1 isoform 1 ... 124 1e-26 gb|EXB25444.1| Endoplasmic oxidoreductin-1 [Morus notabilis] 122 5e-26 gb|EMJ12666.1| hypothetical protein PRUPE_ppa007482mg [Prunus pe... 120 2e-25 gb|EMJ14724.1| hypothetical protein PRUPE_ppa020591mg [Prunus pe... 119 5e-25 ref|XP_006838671.1| hypothetical protein AMTR_s00002p00243350 [A... 118 7e-25 ref|XP_006468052.1| PREDICTED: endoplasmic oxidoreductin-2-like ... 117 2e-24 ref|XP_006449012.1| hypothetical protein CICLE_v10015325mg [Citr... 117 2e-24 ref|XP_006390680.1| hypothetical protein EUTSA_v10018491mg [Eutr... 115 5e-24 ref|XP_006302221.1| hypothetical protein CARUB_v10020240mg [Caps... 115 6e-24 ref|XP_004293538.1| PREDICTED: endoplasmic oxidoreductin-1-like ... 114 1e-23 >ref|XP_006366773.1| PREDICTED: endoplasmic oxidoreductin-1-like [Solanum tuberosum] Length = 474 Score = 130 bits (326), Expect = 2e-28 Identities = 55/61 (90%), Positives = 57/61 (93%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 KSC C QDSRKYTGIVEDCCCDYETVD++NGAVLHPLLQ LV TPFFRYFKVKLWCDCPF Sbjct: 50 KSCPCFQDSRKYTGIVEDCCCDYETVDTINGAVLHPLLQGLVTTPFFRYFKVKLWCDCPF 109 Query: 5 W 3 W Sbjct: 110 W 110 >ref|XP_004243200.1| PREDICTED: endoplasmic oxidoreductin-1-like [Solanum lycopersicum] Length = 473 Score = 130 bits (326), Expect = 2e-28 Identities = 55/61 (90%), Positives = 57/61 (93%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 KSC C QDSRKYTGIVEDCCCDYETVD++NGAVLHPLLQ LV TPFFRYFKVKLWCDCPF Sbjct: 50 KSCPCFQDSRKYTGIVEDCCCDYETVDAINGAVLHPLLQGLVTTPFFRYFKVKLWCDCPF 109 Query: 5 W 3 W Sbjct: 110 W 110 >ref|XP_006478010.1| PREDICTED: endoplasmic oxidoreductin-1-like isoform X2 [Citrus sinensis] Length = 477 Score = 126 bits (316), Expect = 3e-27 Identities = 56/72 (77%), Positives = 60/72 (83%), Gaps = 3/72 (4%) Frame = -1 Query: 209 IAITSKNQKSCQCS---QDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRY 39 IA+ + NQ SC CS QDS KYTG+VEDCCCDYETVDS+NG VLHPLLQ LV TPFFRY Sbjct: 48 IALFANNQTSCHCSSSSQDSVKYTGMVEDCCCDYETVDSVNGEVLHPLLQQLVTTPFFRY 107 Query: 38 FKVKLWCDCPFW 3 FK KLWCDCPFW Sbjct: 108 FKAKLWCDCPFW 119 >ref|XP_006478009.1| PREDICTED: endoplasmic oxidoreductin-1-like isoform X1 [Citrus sinensis] Length = 478 Score = 126 bits (316), Expect = 3e-27 Identities = 56/72 (77%), Positives = 60/72 (83%), Gaps = 3/72 (4%) Frame = -1 Query: 209 IAITSKNQKSCQCS---QDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRY 39 IA+ + NQ SC CS QDS KYTG+VEDCCCDYETVDS+NG VLHPLLQ LV TPFFRY Sbjct: 48 IALFANNQTSCHCSSSSQDSVKYTGMVEDCCCDYETVDSVNGEVLHPLLQQLVTTPFFRY 107 Query: 38 FKVKLWCDCPFW 3 FK KLWCDCPFW Sbjct: 108 FKAKLWCDCPFW 119 >ref|XP_006441012.1| hypothetical protein CICLE_v10019948mg [Citrus clementina] gi|557543274|gb|ESR54252.1| hypothetical protein CICLE_v10019948mg [Citrus clementina] Length = 477 Score = 126 bits (316), Expect = 3e-27 Identities = 56/72 (77%), Positives = 60/72 (83%), Gaps = 3/72 (4%) Frame = -1 Query: 209 IAITSKNQKSCQCS---QDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRY 39 IA+ + NQ SC CS QDS KYTG+VEDCCCDYETVDS+NG VLHPLLQ LV TPFFRY Sbjct: 48 IALFANNQTSCHCSSSSQDSVKYTGMVEDCCCDYETVDSVNGEVLHPLLQQLVTTPFFRY 107 Query: 38 FKVKLWCDCPFW 3 FK KLWCDCPFW Sbjct: 108 FKAKLWCDCPFW 119 >ref|XP_006441011.1| hypothetical protein CICLE_v10019948mg [Citrus clementina] gi|557543273|gb|ESR54251.1| hypothetical protein CICLE_v10019948mg [Citrus clementina] Length = 478 Score = 126 bits (316), Expect = 3e-27 Identities = 56/72 (77%), Positives = 60/72 (83%), Gaps = 3/72 (4%) Frame = -1 Query: 209 IAITSKNQKSCQCS---QDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRY 39 IA+ + NQ SC CS QDS KYTG+VEDCCCDYETVDS+NG VLHPLLQ LV TPFFRY Sbjct: 48 IALFANNQTSCHCSSSSQDSVKYTGMVEDCCCDYETVDSVNGEVLHPLLQQLVTTPFFRY 107 Query: 38 FKVKLWCDCPFW 3 FK KLWCDCPFW Sbjct: 108 FKAKLWCDCPFW 119 >ref|XP_002298934.2| hypothetical protein POPTR_0001s42700g [Populus trichocarpa] gi|550349635|gb|EEE83739.2| hypothetical protein POPTR_0001s42700g [Populus trichocarpa] Length = 482 Score = 125 bits (315), Expect = 4e-27 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 2/70 (2%) Frame = -1 Query: 206 AITSKNQKSCQCS--QDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFK 33 ++ S N KSCQCS QDS KY G++EDCCCDYE+VDS+NG VLHPLLQ+LV TPFFRYFK Sbjct: 53 SLISSNYKSCQCSSAQDSGKYKGMIEDCCCDYESVDSVNGEVLHPLLQELVTTPFFRYFK 112 Query: 32 VKLWCDCPFW 3 VKLWCDCPFW Sbjct: 113 VKLWCDCPFW 122 >ref|XP_006370451.1| Endoplasmic oxidoreductin 1 precursor family protein [Populus trichocarpa] gi|550349634|gb|ERP67020.1| Endoplasmic oxidoreductin 1 precursor family protein [Populus trichocarpa] Length = 426 Score = 125 bits (315), Expect = 4e-27 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 2/70 (2%) Frame = -1 Query: 206 AITSKNQKSCQCS--QDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFK 33 ++ S N KSCQCS QDS KY G++EDCCCDYE+VDS+NG VLHPLLQ+LV TPFFRYFK Sbjct: 53 SLISSNYKSCQCSSAQDSGKYKGMIEDCCCDYESVDSVNGEVLHPLLQELVTTPFFRYFK 112 Query: 32 VKLWCDCPFW 3 VKLWCDCPFW Sbjct: 113 VKLWCDCPFW 122 >ref|XP_002317004.2| Endoplasmic oxidoreductin 1 precursor family protein [Populus trichocarpa] gi|550328376|gb|EEE97616.2| Endoplasmic oxidoreductin 1 precursor family protein [Populus trichocarpa] Length = 470 Score = 125 bits (315), Expect = 4e-27 Identities = 53/70 (75%), Positives = 61/70 (87%), Gaps = 2/70 (2%) Frame = -1 Query: 206 AITSKNQKSCQC--SQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFK 33 ++ + N KSCQC SQDS KY G++EDCCCDYE+VDS+NG VLHPLLQ+LV TPFFRYFK Sbjct: 53 SLINSNNKSCQCPSSQDSGKYKGVIEDCCCDYESVDSVNGEVLHPLLQELVTTPFFRYFK 112 Query: 32 VKLWCDCPFW 3 VKLWCDCPFW Sbjct: 113 VKLWCDCPFW 122 >gb|EOY27645.1| Endoplasmic reticulum oxidoreductins 1 isoform 2 [Theobroma cacao] Length = 372 Score = 124 bits (312), Expect = 1e-26 Identities = 52/69 (75%), Positives = 58/69 (84%) Frame = -1 Query: 209 IAITSKNQKSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKV 30 I++ KSC CSQD KY+GIV+DCCCDYETVD LN VLHPLLQ+LV+TPFFRYFKV Sbjct: 41 ISLFGHTNKSCLCSQDKHKYSGIVQDCCCDYETVDHLNEEVLHPLLQELVKTPFFRYFKV 100 Query: 29 KLWCDCPFW 3 KLWCDCPFW Sbjct: 101 KLWCDCPFW 109 >gb|EOY27644.1| Endoplasmic reticulum oxidoreductins 1 isoform 1 [Theobroma cacao] Length = 466 Score = 124 bits (312), Expect = 1e-26 Identities = 52/69 (75%), Positives = 58/69 (84%) Frame = -1 Query: 209 IAITSKNQKSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKV 30 I++ KSC CSQD KY+GIV+DCCCDYETVD LN VLHPLLQ+LV+TPFFRYFKV Sbjct: 41 ISLFGHTNKSCLCSQDKHKYSGIVQDCCCDYETVDHLNEEVLHPLLQELVKTPFFRYFKV 100 Query: 29 KLWCDCPFW 3 KLWCDCPFW Sbjct: 101 KLWCDCPFW 109 >gb|EXB25444.1| Endoplasmic oxidoreductin-1 [Morus notabilis] Length = 450 Score = 122 bits (306), Expect = 5e-26 Identities = 50/69 (72%), Positives = 59/69 (85%) Frame = -1 Query: 209 IAITSKNQKSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKV 30 I++ ++ K C+C +D RKY+GIVEDCCCDYETVD LN VLHP LQ+LV+TPFFRYFKV Sbjct: 33 ISLFGQSNKPCRCDRDMRKYSGIVEDCCCDYETVDRLNEEVLHPSLQELVKTPFFRYFKV 92 Query: 29 KLWCDCPFW 3 KLWCDCPFW Sbjct: 93 KLWCDCPFW 101 >gb|EMJ12666.1| hypothetical protein PRUPE_ppa007482mg [Prunus persica] Length = 366 Score = 120 bits (300), Expect = 2e-25 Identities = 48/69 (69%), Positives = 58/69 (84%) Frame = -1 Query: 209 IAITSKNQKSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKV 30 I+ ++ K C C+Q++ KY+GIVEDCCCDYETVD +N VLHP LQ+LV+TPFFRYFKV Sbjct: 35 ISFFGRSNKPCNCTQETHKYSGIVEDCCCDYETVDHINKEVLHPSLQELVKTPFFRYFKV 94 Query: 29 KLWCDCPFW 3 KLWCDCPFW Sbjct: 95 KLWCDCPFW 103 >gb|EMJ14724.1| hypothetical protein PRUPE_ppa020591mg [Prunus persica] Length = 450 Score = 119 bits (297), Expect = 5e-25 Identities = 49/69 (71%), Positives = 57/69 (82%) Frame = -1 Query: 209 IAITSKNQKSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKV 30 +++ KN SC C QDS+ YTGIVEDCCCDYETVDS+N VLHPLLQ++V+T FF YFK Sbjct: 42 LSLFFKNPNSCHCPQDSKGYTGIVEDCCCDYETVDSVNAEVLHPLLQEIVKTLFFIYFKA 101 Query: 29 KLWCDCPFW 3 KLWCDCPFW Sbjct: 102 KLWCDCPFW 110 >ref|XP_006838671.1| hypothetical protein AMTR_s00002p00243350 [Amborella trichopoda] gi|548841177|gb|ERN01240.1| hypothetical protein AMTR_s00002p00243350 [Amborella trichopoda] Length = 448 Score = 118 bits (296), Expect = 7e-25 Identities = 50/63 (79%), Positives = 56/63 (88%) Frame = -1 Query: 191 NQKSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDC 12 + K CQC + SRKYTG+VEDCCCDYETVD+LN VLHP+LQ+LV TPFFRYFKVKLWCDC Sbjct: 42 SNKPCQCPE-SRKYTGLVEDCCCDYETVDALNQEVLHPILQELVATPFFRYFKVKLWCDC 100 Query: 11 PFW 3 PFW Sbjct: 101 PFW 103 >ref|XP_006468052.1| PREDICTED: endoplasmic oxidoreductin-2-like isoform X1 [Citrus sinensis] gi|568827405|ref|XP_006468053.1| PREDICTED: endoplasmic oxidoreductin-2-like isoform X2 [Citrus sinensis] Length = 467 Score = 117 bits (293), Expect = 2e-24 Identities = 47/61 (77%), Positives = 54/61 (88%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 KSC C+Q+ KY+G+VEDCCCDYETV+ LN VLHP LQ+LV+TPFFRYFKVKLWCDCPF Sbjct: 52 KSCHCAQEKDKYSGVVEDCCCDYETVNQLNEQVLHPSLQELVKTPFFRYFKVKLWCDCPF 111 Query: 5 W 3 W Sbjct: 112 W 112 >ref|XP_006449012.1| hypothetical protein CICLE_v10015325mg [Citrus clementina] gi|557551623|gb|ESR62252.1| hypothetical protein CICLE_v10015325mg [Citrus clementina] Length = 429 Score = 117 bits (293), Expect = 2e-24 Identities = 47/61 (77%), Positives = 54/61 (88%) Frame = -1 Query: 185 KSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCDCPF 6 KSC C+Q+ KY+G+VEDCCCDYETV+ LN VLHP LQ+LV+TPFFRYFKVKLWCDCPF Sbjct: 52 KSCHCAQEKDKYSGVVEDCCCDYETVNQLNEQVLHPSLQELVKTPFFRYFKVKLWCDCPF 111 Query: 5 W 3 W Sbjct: 112 W 112 >ref|XP_006390680.1| hypothetical protein EUTSA_v10018491mg [Eutrema salsugineum] gi|557087114|gb|ESQ27966.1| hypothetical protein EUTSA_v10018491mg [Eutrema salsugineum] Length = 470 Score = 115 bits (289), Expect = 5e-24 Identities = 50/64 (78%), Positives = 56/64 (87%), Gaps = 1/64 (1%) Frame = -1 Query: 191 NQKSCQCS-QDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKVKLWCD 15 ++ SC CS Q++ KY GIVEDCCCDYETVD+LN VL+PLLQDLV TPFFRYFKVKLWCD Sbjct: 48 DRNSCSCSLQETGKYKGIVEDCCCDYETVDNLNSEVLNPLLQDLVSTPFFRYFKVKLWCD 107 Query: 14 CPFW 3 CPFW Sbjct: 108 CPFW 111 >ref|XP_006302221.1| hypothetical protein CARUB_v10020240mg [Capsella rubella] gi|482570931|gb|EOA35119.1| hypothetical protein CARUB_v10020240mg [Capsella rubella] Length = 467 Score = 115 bits (288), Expect = 6e-24 Identities = 50/70 (71%), Positives = 57/70 (81%), Gaps = 1/70 (1%) Frame = -1 Query: 209 IAITSKNQKSCQCS-QDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFK 33 + S ++ SC CS Q + KY G+VEDCCCDYETVD+LN VL+PLLQDLV TPFFRYFK Sbjct: 42 VGFFSSDRNSCSCSLQGTGKYKGMVEDCCCDYETVDNLNSEVLNPLLQDLVTTPFFRYFK 101 Query: 32 VKLWCDCPFW 3 VKLWCDCPFW Sbjct: 102 VKLWCDCPFW 111 >ref|XP_004293538.1| PREDICTED: endoplasmic oxidoreductin-1-like [Fragaria vesca subsp. vesca] Length = 489 Score = 114 bits (286), Expect = 1e-23 Identities = 47/69 (68%), Positives = 55/69 (79%) Frame = -1 Query: 209 IAITSKNQKSCQCSQDSRKYTGIVEDCCCDYETVDSLNGAVLHPLLQDLVRTPFFRYFKV 30 I + + K C C+Q KY+G+VEDCCCDYETVD LN VL+P LQ+LV+TPFFRYFKV Sbjct: 34 IGLFGSSNKPCNCTQGGNKYSGMVEDCCCDYETVDRLNKDVLNPSLQELVKTPFFRYFKV 93 Query: 29 KLWCDCPFW 3 KLWCDCPFW Sbjct: 94 KLWCDCPFW 102