BLASTX nr result
ID: Rehmannia25_contig00021142
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00021142 (408 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006434926.1| hypothetical protein CICLE_v10002023mg [Citr... 87 3e-15 gb|EOY14677.1| GNS1/SUR4 membrane protein family [Theobroma cacao] 86 4e-15 ref|XP_006473449.1| PREDICTED: elongation of fatty acids protein... 86 5e-15 ref|XP_002310199.1| hypothetical protein POPTR_0007s12290g [Popu... 85 9e-15 ref|XP_006346848.1| PREDICTED: putative elongation of fatty acid... 84 2e-14 ref|XP_004300594.1| PREDICTED: uncharacterized protein LOC101294... 84 2e-14 ref|XP_002533270.1| conserved hypothetical protein [Ricinus comm... 84 2e-14 ref|XP_004232095.1| PREDICTED: putative elongation of fatty acid... 83 3e-14 ref|XP_003538839.1| PREDICTED: elongation of fatty acids protein... 82 7e-14 ref|XP_006338760.1| PREDICTED: putative elongation of fatty acid... 82 1e-13 ref|XP_004157860.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 80 4e-13 ref|XP_004141955.1| PREDICTED: uncharacterized protein LOC101205... 80 4e-13 ref|XP_004512005.1| PREDICTED: putative elongation of fatty acid... 79 8e-13 gb|EMJ03479.1| hypothetical protein PRUPE_ppa008998mg [Prunus pe... 77 2e-12 ref|XP_004234683.1| PREDICTED: putative elongation of fatty acid... 77 2e-12 gb|EOX91191.1| GNS1/SUR4 membrane protein family [Theobroma cacao] 76 4e-12 ref|XP_002283511.1| PREDICTED: elongation of fatty acids protein... 76 5e-12 ref|XP_006856126.1| hypothetical protein AMTR_s00059p00152210 [A... 74 2e-11 ref|XP_003611912.1| hypothetical protein MTR_5g019330 [Medicago ... 74 2e-11 ref|XP_004499120.1| PREDICTED: putative elongation of fatty acid... 74 2e-11 >ref|XP_006434926.1| hypothetical protein CICLE_v10002023mg [Citrus clementina] gi|557537048|gb|ESR48166.1| hypothetical protein CICLE_v10002023mg [Citrus clementina] Length = 295 Score = 86.7 bits (213), Expect = 3e-15 Identities = 44/70 (62%), Positives = 49/70 (70%) Frame = -3 Query: 406 HFGVLLLHFIKGGCNGIGAWIFNSVLNGAILFLFLNFYVKRYLRKIKAGVAAVDGGCLVA 227 HFGVLLLH +KGGCNGIGAW FNSVLN IL LF+NFYVK YLR K G A+ Sbjct: 226 HFGVLLLHVLKGGCNGIGAWTFNSVLNAVILLLFMNFYVKMYLRNKKIGDASSSAEQSNG 285 Query: 226 EKMEMVKDKD 197 +M + KDKD Sbjct: 286 GQMNL-KDKD 294 >gb|EOY14677.1| GNS1/SUR4 membrane protein family [Theobroma cacao] Length = 298 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/56 (69%), Positives = 45/56 (80%) Frame = -3 Query: 406 HFGVLLLHFIKGGCNGIGAWIFNSVLNGAILFLFLNFYVKRYLRKIKAGVAAVDGG 239 HFGV+ LHF+KGGCNG+GAW FNSVLNG IL+LFLNFYVKR+LRK + GG Sbjct: 228 HFGVIFLHFLKGGCNGMGAWGFNSVLNGVILWLFLNFYVKRHLRKRNVDDVSGHGG 283 >ref|XP_006473449.1| PREDICTED: elongation of fatty acids protein 2-like [Citrus sinensis] Length = 295 Score = 85.9 bits (211), Expect = 5e-15 Identities = 44/70 (62%), Positives = 49/70 (70%) Frame = -3 Query: 406 HFGVLLLHFIKGGCNGIGAWIFNSVLNGAILFLFLNFYVKRYLRKIKAGVAAVDGGCLVA 227 HFGVLLLH +KGGCNGIGAW FNSVLN IL LF+NFYVK YLR K G A+ Sbjct: 226 HFGVLLLHVLKGGCNGIGAWTFNSVLNAVILLLFMNFYVKMYLRNKKIGDASSAAEQSNG 285 Query: 226 EKMEMVKDKD 197 +M + KDKD Sbjct: 286 GQMNL-KDKD 294 >ref|XP_002310199.1| hypothetical protein POPTR_0007s12290g [Populus trichocarpa] gi|222853102|gb|EEE90649.1| hypothetical protein POPTR_0007s12290g [Populus trichocarpa] Length = 279 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/47 (85%), Positives = 41/47 (87%) Frame = -3 Query: 406 HFGVLLLHFIKGGCNGIGAWIFNSVLNGAILFLFLNFYVKRYLRKIK 266 H GVL LHF+KGGCNGIGAW FNSVLNGAILFLFLNFYVK YL K K Sbjct: 226 HVGVLSLHFMKGGCNGIGAWWFNSVLNGAILFLFLNFYVKMYLGKRK 272 >ref|XP_006346848.1| PREDICTED: putative elongation of fatty acids protein DDB_G0272012-like [Solanum tuberosum] Length = 291 Score = 84.3 bits (207), Expect = 2e-14 Identities = 43/73 (58%), Positives = 51/73 (69%), Gaps = 3/73 (4%) Frame = -3 Query: 406 HFGVLLLHFIKGGCNGIGAWIFNSVLNGAILFLFLNFYVKRYL---RKIKAGVAAVDGGC 236 H GVLLLHF++GGCNGIGAW+ NSVLNGAILF FLN+YVK +L RKI+A Sbjct: 231 HIGVLLLHFLRGGCNGIGAWVLNSVLNGAILFFFLNYYVKLHLEEKRKIRAA-------- 282 Query: 235 LVAEKMEMVKDKD 197 +M+KDKD Sbjct: 283 -----KQMLKDKD 290 >ref|XP_004300594.1| PREDICTED: uncharacterized protein LOC101294269 [Fragaria vesca subsp. vesca] Length = 298 Score = 84.0 bits (206), Expect = 2e-14 Identities = 42/70 (60%), Positives = 50/70 (71%) Frame = -3 Query: 406 HFGVLLLHFIKGGCNGIGAWIFNSVLNGAILFLFLNFYVKRYLRKIKAGVAAVDGGCLVA 227 H GVL++HF+KGGCNGIGAW FNSVLN IL LFLNFYVK + KA +A V+ A Sbjct: 226 HVGVLMMHFMKGGCNGIGAWGFNSVLNAVILLLFLNFYVKIHWGYGKAALAKVEEAEAKA 285 Query: 226 EKMEMVKDKD 197 E+ E V+ KD Sbjct: 286 EEEEQVRAKD 295 >ref|XP_002533270.1| conserved hypothetical protein [Ricinus communis] gi|223526895|gb|EEF29102.1| conserved hypothetical protein [Ricinus communis] Length = 295 Score = 84.0 bits (206), Expect = 2e-14 Identities = 39/47 (82%), Positives = 41/47 (87%) Frame = -3 Query: 406 HFGVLLLHFIKGGCNGIGAWIFNSVLNGAILFLFLNFYVKRYLRKIK 266 H GVLLLH +KGGCNGIGAWIFNSVLNGAIL LFLNFYVK +L K K Sbjct: 232 HVGVLLLHLMKGGCNGIGAWIFNSVLNGAILLLFLNFYVKMHLAKKK 278 >ref|XP_004232095.1| PREDICTED: putative elongation of fatty acids protein DDB_G0272012-like [Solanum lycopersicum] Length = 277 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -3 Query: 406 HFGVLLLHFIKGGCNGIGAWIFNSVLNGAILFLFLNFYVKRYLR 275 H GVLLLHF+KGGCNGIGAW+FNSVLN AILFLFLNFYVK +L+ Sbjct: 226 HVGVLLLHFMKGGCNGIGAWLFNSVLNAAILFLFLNFYVKVHLK 269 >ref|XP_003538839.1| PREDICTED: elongation of fatty acids protein A-like [Glycine max] Length = 323 Score = 82.0 bits (201), Expect = 7e-14 Identities = 39/58 (67%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = -3 Query: 406 HFGVLLLHFIKGGCNGIGAWIFNSVLNGAILFLFLNFYVKRYL-RKIKAGVAAVDGGC 236 H VLLLHF+ GGCNGIGAW+FNSVLNGAIL LFLNFYV+ YL R+ K +D C Sbjct: 240 HVAVLLLHFLTGGCNGIGAWVFNSVLNGAILLLFLNFYVRMYLARRRKRKGVVIDHRC 297 >ref|XP_006338760.1| PREDICTED: putative elongation of fatty acids protein DDB_G0272012-like [Solanum tuberosum] Length = 284 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 406 HFGVLLLHFIKGGCNGIGAWIFNSVLNGAILFLFLNFYVK 287 H GVLLLHF+KGGCNGIGAW+FNSVLN AILFLFLNFYVK Sbjct: 226 HVGVLLLHFMKGGCNGIGAWVFNSVLNAAILFLFLNFYVK 265 >ref|XP_004157860.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101229590 [Cucumis sativus] Length = 316 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -3 Query: 406 HFGVLLLHFIKGGCNGIGAWIFNSVLNGAILFLFLNFYVKRYL 278 H GVLLLHF+KGGCNGIGAW FNSVLNGAIL LFLNFY+K +L Sbjct: 231 HVGVLLLHFMKGGCNGIGAWSFNSVLNGAILLLFLNFYLKIHL 273 >ref|XP_004141955.1| PREDICTED: uncharacterized protein LOC101205262 [Cucumis sativus] Length = 316 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -3 Query: 406 HFGVLLLHFIKGGCNGIGAWIFNSVLNGAILFLFLNFYVKRYL 278 H GVLLLHF+KGGCNGIGAW FNSVLNGAIL LFLNFY+K +L Sbjct: 231 HVGVLLLHFMKGGCNGIGAWSFNSVLNGAILLLFLNFYLKIHL 273 >ref|XP_004512005.1| PREDICTED: putative elongation of fatty acids protein 1-like [Cicer arietinum] Length = 279 Score = 78.6 bits (192), Expect = 8e-13 Identities = 36/47 (76%), Positives = 39/47 (82%) Frame = -3 Query: 406 HFGVLLLHFIKGGCNGIGAWIFNSVLNGAILFLFLNFYVKRYLRKIK 266 H GVLLLHF +GGCNGIGAW+FNS LN AILFLFL FYV+ YL K K Sbjct: 231 HVGVLLLHFFRGGCNGIGAWVFNSFLNCAILFLFLKFYVRVYLGKRK 277 >gb|EMJ03479.1| hypothetical protein PRUPE_ppa008998mg [Prunus persica] Length = 311 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/56 (62%), Positives = 41/56 (73%) Frame = -3 Query: 406 HFGVLLLHFIKGGCNGIGAWIFNSVLNGAILFLFLNFYVKRYLRKIKAGVAAVDGG 239 H GVL+LHF++GGCNGIG W+FNSVLNG IL FLNFYV+ +L K G GG Sbjct: 230 HVGVLMLHFMRGGCNGIGVWVFNSVLNGVILLAFLNFYVRIHLGFDKKGRTGGGGG 285 >ref|XP_004234683.1| PREDICTED: putative elongation of fatty acids protein DDB_G0272012-like [Solanum lycopersicum] Length = 287 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = -3 Query: 406 HFGVLLLHFIKGGCNGIGAWIFNSVLNGAILFLFLNFYVKRYLRK 272 H GVLLLH ++GGCNGIGAWI NSVLN AILF FLN+YVK +L K Sbjct: 231 HVGVLLLHLLRGGCNGIGAWILNSVLNAAILFFFLNYYVKLHLEK 275 >gb|EOX91191.1| GNS1/SUR4 membrane protein family [Theobroma cacao] Length = 283 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/71 (54%), Positives = 46/71 (64%) Frame = -3 Query: 406 HFGVLLLHFIKGGCNGIGAWIFNSVLNGAILFLFLNFYVKRYLRKIKAGVAAVDGGCLVA 227 H GVL LHF+KGGCNGIGAW+ NSVLNG IL LFL FYV+ + K A Sbjct: 224 HVGVLTLHFMKGGCNGIGAWVLNSVLNGVILLLFLKFYVQSRRKDGKQ-----------A 272 Query: 226 EKMEMVKDKDI 194 + E+VKDKD+ Sbjct: 273 KLQEIVKDKDL 283 >ref|XP_002283511.1| PREDICTED: elongation of fatty acids protein A [Vitis vinifera] Length = 301 Score = 75.9 bits (185), Expect = 5e-12 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = -3 Query: 406 HFGVLLLHFIKGGCNGIGAWIFNSVLNGAILFLFLNFYVKRYLRK 272 HFGVL LHF+KGGCNGIGA +FNSVLN IL LFLNFYVK +L + Sbjct: 223 HFGVLFLHFLKGGCNGIGACVFNSVLNAFILLLFLNFYVKMHLSR 267 >ref|XP_006856126.1| hypothetical protein AMTR_s00059p00152210 [Amborella trichopoda] gi|548859985|gb|ERN17593.1| hypothetical protein AMTR_s00059p00152210 [Amborella trichopoda] Length = 283 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -3 Query: 406 HFGVLLLHFIKGGCNGIGAWIFNSVLNGAILFLFLNFYVKRYLR 275 H GVL+LH K GCNGIGAW FNSV+NGA+LFLFLNFY+K++L+ Sbjct: 226 HLGVLVLHLGKEGCNGIGAWGFNSVMNGALLFLFLNFYLKKHLK 269 >ref|XP_003611912.1| hypothetical protein MTR_5g019330 [Medicago truncatula] gi|355513247|gb|AES94870.1| hypothetical protein MTR_5g019330 [Medicago truncatula] Length = 302 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -3 Query: 406 HFGVLLLHFIKGGCNGIGAWIFNSVLNGAILFLFLNFYVKRYLRKIK 266 H GVLLLH +GGCNGIGAW+FNS+LNG IL LF+NFYV+ +K K Sbjct: 231 HVGVLLLHLFRGGCNGIGAWVFNSILNGVILLLFVNFYVRANGKKKK 277 >ref|XP_004499120.1| PREDICTED: putative elongation of fatty acids protein 1-like [Cicer arietinum] Length = 292 Score = 73.9 bits (180), Expect = 2e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -3 Query: 406 HFGVLLLHFIKGGCNGIGAWIFNSVLNGAILFLFLNFYV 290 H GVL LH ++GGCNGIGAW+FNSVLN AILFLFLNFY+ Sbjct: 232 HVGVLWLHLLRGGCNGIGAWVFNSVLNAAILFLFLNFYI 270