BLASTX nr result
ID: Rehmannia25_contig00020817
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00020817 (401 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS59689.1| hypothetical protein M569_15117 [Genlisea aurea] 67 2e-09 >gb|EPS59689.1| hypothetical protein M569_15117 [Genlisea aurea] Length = 550 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/79 (39%), Positives = 47/79 (59%) Frame = +1 Query: 163 FEARQLTLPKPLHTASPHVAALLYDPISRSVALRHXXXXXXXXXXXXXXXXXXXXXXXXX 342 FEAR+L+LPKPL+ +P +++ +YDP+S S+ALRH Sbjct: 19 FEARELSLPKPLYAQTPKISSFIYDPVSASMALRHFDSSFSLYFNFSPISNPNFPPPKAV 78 Query: 343 IPSPTSSAAFLHLRTAANS 399 +P PTS+AAFLH+RT +++ Sbjct: 79 VPCPTSAAAFLHIRTGSST 97