BLASTX nr result
ID: Rehmannia25_contig00020128
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00020128 (711 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006352141.1| PREDICTED: putative pentatricopeptide repeat... 57 6e-06 ref|XP_004234885.1| PREDICTED: putative pentatricopeptide repeat... 57 6e-06 >ref|XP_006352141.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330-like [Solanum tuberosum] Length = 618 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/45 (53%), Positives = 34/45 (75%) Frame = +2 Query: 2 LDPNEADPYLIVSNTYSANQSWEEAAKFRGLMLESEGTKLPGQSW 136 L P+E PY+++SNT S +++W+EA+K RGLM E + K PGQSW Sbjct: 573 LQPSEHSPYILLSNTCSEHENWDEASKLRGLMQERKVMKHPGQSW 617 >ref|XP_004234885.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330-like [Solanum lycopersicum] Length = 616 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/45 (53%), Positives = 34/45 (75%) Frame = +2 Query: 2 LDPNEADPYLIVSNTYSANQSWEEAAKFRGLMLESEGTKLPGQSW 136 L P+E PY+++SNT S +++W+EA+K RGLM E + K PGQSW Sbjct: 571 LQPSEHSPYILLSNTCSEHENWDEASKLRGLMQERKVMKHPGQSW 615